Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP1R, Human (HEK293, N-His, C-Myc)

The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

GLP1R Protein, Human (HEK293, N-His, C-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glp1r-protein-human-hek293-n-his-c-myc.html

Purity

98.0

Smiles

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Molecular Formula

2740 (Gene_ID) P43220 (R24-Y145) (Accession)

Molecular Weight

Approximately 25-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitro-4-thiocyanato Aniline
TRC-N565320-500MG 500 mg

2-Nitro-4-thiocyanato Aniline

Sign In for Pricing
View Details
SLC30A7 (NM_001144884) Human Over-expression Lysate
LY428544 100 µg

SLC30A7 (NM_001144884) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS503370 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), Biotin conjugate, 0.1mg/mL
BNCB2397-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NIPSNAP2 (NM_001483) Human Over-expression Lysate
LY400571 100 µg

NIPSNAP2 (NM_001483) Human Over-expression Lysate

Sign In for Pricing
View Details
VEGFA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A6]
TA803263AM 100 µL

VEGFA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A6]

Sign In for Pricing
View Details