Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuron navigator 3 (Nav3), partial

Product Specifications

Product Name Alternative

Neuron navigator 3 (Pore membrane and/or filament-interacting-like protein 1)

Abbreviation

Recombinant Mouse Nav3 protein, partial

Gene Name

Nav3

UniProt

Q80TN7

Expression Region

77-184aa

Organism

Mus musculus (Mouse)

Target Sequence

EDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

May regulate IL2 production by T-cells. May be involved in neuron regeneration.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.9 kDa

References & Citations

"Pore membrane and/or filament interacting like protein 1 (POMFIL1) is predominantly expressed in the nervous system and encodes different protein isoforms." Coy J.F., Wiemann S., Bechmann I., Baechner D., Nitsch R., Kretz O., Christiansen H., Poustka A. Gene 290:73-94 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf26 Rabbit Polyclonal Antibody (HRP)
orb478647 100 µL

C3orf26 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TNNT2 (Cardiac Muscle Troponin T, Troponin T, Cardiac Muscle, Troponin T type 2 (cardiac), cTnT, TnTC) (HRP)
MBS6441152-01 0.1 mL

TNNT2 (Cardiac Muscle Troponin T, Troponin T, Cardiac Muscle, Troponin T type 2 (cardiac), cTnT, TnTC) (HRP)

Sign In for Pricing
View Details
TNNT2 (Cardiac Muscle Troponin T, Troponin T, Cardiac Muscle, Troponin T type 2 (cardiac), cTnT, TnTC) (HRP)
MBS6441152-02 5x 0.1 mL

TNNT2 (Cardiac Muscle Troponin T, Troponin T, Cardiac Muscle, Troponin T type 2 (cardiac), cTnT, TnTC) (HRP)

Sign In for Pricing
View Details
DUSP14 (C) Antibody, Rabbit Polyclonal
orb387422 100 µL

DUSP14 (C) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
MBS1020350-01 0.02 mg (E-Coli)

Recombinant Burkholderia mallei Bis (5'-nucleosyl) -tetraphosphatase, symmetrical

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
MBS1020350-02 0.02 mg (Yeast)

Recombinant Burkholderia mallei Bis (5'-nucleosyl) -tetraphosphatase, symmetrical

Sign In for Pricing
View Details