Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glutamicibacter nicotianae Adenylate cyclase (cya) (D403A)

Product Specifications

CAS Number

9000-83-3

Gene Name

cya

UniProt

P27580

Expression Region

1-403aa (D403A)

Organism

Glutamicibacter nicotianae (Arthrobacter nicotianae)

Target Sequence

MSTEHTNTPRADSPQSAAEAVRGARQHAPAATPAESDPILELAEAMEGPLRIPAHTPEAVRDTVASLEKRLIGGQREFRRREVASEAGVSLHSARKLWRAIGFPELSDDEVFFTEADKKALGTMVGMVREGALTEETAISLMRSVGQMTDRMVVWQIEALVEDMIANQNLSDRQARRQLFSLLPEIIPAIEDLLLYSWRRQLNSAVHRMALRVETGVAAYNQDRGEDDGGTPLPLARAVGFADLVSYTSLSRRMNERTLAQLVQRFEAKCAEIISVGGGRLVKTIGDEVLYVAETPQAGAQIALSLSRELAKDELFPQTRGAVVWGRLLSRLGDIYGPTVNMAARLTSLAEPGTVLTDAITANTLRNDARFVLTAQEITAVRGFGDIQPYELSAGEGAGLVID

Tag

C-terminal 6xHis-tagged

Source

E.coli

Field of Research

Others

Assay Type

Developed Protein

Relevance

Plays essential roles in regulation of cellular metabolism by catalyzing the synthesis of a second messenger, cAMP.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL
BNC880028-500 1x 500 µL

CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791), CF647 conjugate, 0.1mg/mL
BNC470791-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + KRT7/903), CF405S conjugate, 0.1mg/mL
BNC040906-500 1x 500 µL

Cytokeratin 7 (KRT7/760 + KRT7/903), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details