Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine receptor A1 (ADORA1)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human ADORA1 protein

Gene Name

ADORA1

UniProt

P30542

Expression Region

1-326aa

Organism

Homo sapiens (Human)

Target Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

G-protein coupled receptor, Receptor, Transducer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI6B12]
CF807226 100 µg

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI6B12]

Sign In for Pricing
View Details
TP53I3 Antibody
KC-2273-01 50 μL

TP53I3 Antibody

Sign In for Pricing
View Details
TP53I3 Antibody
KC-2273-02 100 µL

TP53I3 Antibody

Sign In for Pricing
View Details
TP53I3 Antibody
KC-2273-03 1 mL

TP53I3 Antibody

Sign In for Pricing
View Details
Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit
E-EL-H0090-01 24 Tests

Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit

Sign In for Pricing
View Details
Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit
E-EL-H0090-02 48 Tests

Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit

Sign In for Pricing
View Details