Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1)

Product Specifications

Abbreviation

Recombinant Mouse Cthrc1 protein

Gene Name

Cthrc1

UniProt

Q9D1D6

Expression Region

33-245aa

Organism

Mus musculus (Mouse)

Target Sequence

SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

May act as a negative regulator of collagen matrix deposition..

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.0 kDa

References & Citations

"Collagen triple helix repeat containing 1 is a new promigratory marker of arthritic pannus." Shekhani M.T., Forde T.S., Adilbayeva A., Ramez M., Myngbay A., Bexeitov Y., Lindner V., Adarichev V.A. Arthritis Res Ther 18:171-171 (2016) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 (Wilm's Tumor 1) (WT1/857), CF640R conjugate, 0.1mg/mL
BNC400857-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/1074), CF647 conjugate, 0.1mg/mL
BNC471017-100 1x 100 µL

SOX10 (SOX10/1074), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL
BNC940041-500 1x 500 µL

Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 / PDCD1 / CD279 (PDCD1/922), CF594 conjugate, 0.1mg/mL
BNC940922-100 1x 100 µL

PD1 / PDCD1 / CD279 (PDCD1/922), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF488A conjugate, 0.1mg/mL
BNC881797-100 1x 100 µL

Histone H1 (Nuclear Marker) (r1415-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details