Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemoglobin subunit zeta/HBAZ, Human (His)

The hemoglobin zeta subunit (HBAZ) protein acts as an α-type chain in mammalian embryonic hemoglobin. It contributes to the formation of heterotetramers and is involved in various developmental stages. Hemoglobin subunit zeta/HBAZ Protein, Human (His) is the recombinant human-derived Hemoglobin subunit zeta/HBAZ protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemoglobin subunit zeta/HBAZ Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemoglobin-subunit-zeta-hbaz-protein-human-his.html

Purity

96.09

Smiles

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

Molecular Formula

3050 (Gene_ID) P02008 (M1-R142) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6α-Methyl prednisone
FM25551-01 1 mg

6α-Methyl prednisone

Sign In for Pricing
View Details
6α-Methyl prednisone
FM25551-02 2 mg

6α-Methyl prednisone

Sign In for Pricing
View Details
6α-Methyl prednisone
FM25551-03 5 mg

6α-Methyl prednisone

Sign In for Pricing
View Details
6α-Methyl prednisone
FM25551-04 10 mg

6α-Methyl prednisone

Sign In for Pricing
View Details
6α-Methyl prednisone
FM25551-05 25 mg

6α-Methyl prednisone

Sign In for Pricing
View Details
KYNU Rabbit pAb
E45R26713N 50 ul

KYNU Rabbit pAb

Sign In for Pricing
View Details