Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELT, Human (HEK293, Fc)

RELT protein may play a role in apoptosis, suggesting its involvement in the complex cellular process of programmed cell death. When overexpressed, RELT activates the MAPK14/p38 and MAPK8/JNK MAPK cascades, affecting key signaling pathways. RELT Protein, Human (HEK293, Fc) is the recombinant human-derived RELT protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

RELT Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/relt-protein-human-hek-293-fc.html

Purity

90.00

Smiles

STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETA

Molecular Formula

84957 (Gene_ID) Q969Z4 (S26-A160) (Accession)

Molecular Weight

40-54 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5B Antibody - N-terminal region : FITC (ARP33379_P050-FITC)
ARP33379_P050-FITC 100 µL

STAT5B Antibody - N-terminal region : FITC (ARP33379_P050-FITC)

Sign In for Pricing
View Details
TREM2 Polyclonal Antibody Cy3 Conjugated
orb1542506 100 µL

TREM2 Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Cupriavidus necator 1-deoxy-D-xylulose-5-phosphate synthase (dxs), partial
MBS1313581 Inquire

Recombinant Cupriavidus necator 1-deoxy-D-xylulose-5-phosphate synthase (dxs), partial

Sign In for Pricing
View Details
RHBDD1 (NM_032276) Human Tagged ORF Clone
RC210708 10 µg

RHBDD1 (NM_032276) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Acidithiobacillus ferrooxidans Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)
MBS1080358-01 0.02 mg (E-Coli)

Recombinant Acidithiobacillus ferrooxidans Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)

Sign In for Pricing
View Details
Recombinant Acidithiobacillus ferrooxidans Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)
MBS1080358-02 0.1 mg (E-Coli)

Recombinant Acidithiobacillus ferrooxidans Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)

Sign In for Pricing
View Details