Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITM2B, Human (HEK293, His)

The ITM2B protein regulates amyloid beta A4 precursor protein (APP) processing by inhibiting amyloid beta peptide aggregation and fibril deposition. In addition to its effects on the amyloid-β pathway, ITM2B also contributes to neurite outgrowth, affecting neurobiological processes. ITM2B Protein, Human (HEK293, His) is the recombinant human-derived ITM2B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ITM2B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/itm2b-protein-human-hek-293-his.html

Purity

98.0

Smiles

YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS

Molecular Formula

9445 (Gene_ID) Q9Y287 (Y76-S266) (Accession)

Molecular Weight

Approximately 29-33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY2 Antibody
43960 100 µL

ADCY2 Antibody

Sign In for Pricing
View Details
OLFML3 Peptide - N-terminal region (AAP48076)
AAP48076-100UG 100 µg

OLFML3 Peptide - N-terminal region (AAP48076)

Sign In for Pricing
View Details
Human Cytochrome b5 Domain Containing Protein 2 (CYB5D2) ELISA Kit
EKN53211 96 Tests

Human Cytochrome b5 Domain Containing Protein 2 (CYB5D2) ELISA Kit

Sign In for Pricing
View Details
Ush1c (NM_212521) Rat Tagged Lenti ORF Clone
RR211758L4 10 µg

Ush1c (NM_212521) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Secretin (SCT) (Not for Export EU)
S0625-05H 50 µL

Secretin (SCT) (Not for Export EU)

Sign In for Pricing
View Details
Alox15b sgRNA CRISPR Lentivector (Rat) (Target 2)
K7344803 1.0 µg DNA

Alox15b sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details