Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPPP3, Human (His)

The TPPP3 protein is a microtubule-associated regulator that exerts a critical influence on microtubule dynamics through bundling activity. Its important role extends to embryonic implantation and decidualization, implicated in reproductive events. TPPP3 Protein, Human (His) is the recombinant human-derived TPPP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TPPP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tppp3-protein-human-his.html

Purity

96.70

Smiles

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

Molecular Formula

51673 (Gene_ID) Q9BW30 (M1-K176) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase lambda (POLL) (NM_013274) Human Recombinant Protein
TP309816L 1 mg

DNA Polymerase lambda (POLL) (NM_013274) Human Recombinant Protein

Sign In for Pricing
View Details
Vhl (NM_009507) Mouse Tagged ORF Clone
MG201630 10 µg

Vhl (NM_009507) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Desmin Antibody
OC-270-01 50 μL

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
OC-270-02 100 µL

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
OC-270-03 1 mL

Desmin Antibody

Sign In for Pricing
View Details
HSPA4 (NM_002154) Human Over-expression Lysate
LC400782 20 µg

HSPA4 (NM_002154) Human Over-expression Lysate

Sign In for Pricing
View Details