Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPPP3, Human (His)

The TPPP3 protein is a microtubule-associated regulator that exerts a critical influence on microtubule dynamics through bundling activity. Its important role extends to embryonic implantation and decidualization, implicated in reproductive events. TPPP3 Protein, Human (His) is the recombinant human-derived TPPP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TPPP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tppp3-protein-human-his.html

Purity

96.70

Smiles

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

Molecular Formula

51673 (Gene_ID) Q9BW30 (M1-K176) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF647 conjugate, 0.1mg/mL
BNC472448-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLAG (HLA-G) Mouse Monoclonal Antibody [Clone ID: 87G]
AM03060RP-N 100 µg

HLAG (HLA-G) Mouse Monoclonal Antibody [Clone ID: 87G]

Sign In for Pricing
View Details
Allylprodine Hydrochloride
TRC-A572300-1MG 1 mg

Allylprodine Hydrochloride

Sign In for Pricing
View Details
Cgas (NM_173386) Mouse Recombinant Protein
TP513022 20 µg

Cgas (NM_173386) Mouse Recombinant Protein

Sign In for Pricing
View Details
IL-1 alpha Recombinant Rabbit monoclonal Antibody
HA751577 100 µL

IL-1 alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
IFluor® 546 goat anti-rabbit IgG (H+L) *Cross Adsorbed*
16688-AAT 200 µg

IFluor® 546 goat anti-rabbit IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details