TPPP3, Human (His)
The TPPP3 protein is a microtubule-associated regulator that exerts a critical influence on microtubule dynamics through bundling activity. Its important role extends to embryonic implantation and decidualization, implicated in reproductive events. TPPP3 Protein, Human (His) is the recombinant human-derived TPPP3 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
TPPP3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tppp3-protein-human-his.html
Purity
96.70
Smiles
MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Molecular Formula
51673 (Gene_ID) Q9BW30 (M1-K176) (Accession)
Molecular Weight
Approximately 19 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2065-500 1x 500 µL
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2065), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740329-500 1x 500 µL
Small Cell Lung Cancer (SCLC) (MOC-52), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942971-500 1x 500 µL
MRP3 (Multidrug Resistance-Associated Protein 3) (ABCC3/2971), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 