Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPPP3, Human (His)

The TPPP3 protein is a microtubule-associated regulator that exerts a critical influence on microtubule dynamics through bundling activity. Its important role extends to embryonic implantation and decidualization, implicated in reproductive events. TPPP3 Protein, Human (His) is the recombinant human-derived TPPP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TPPP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tppp3-protein-human-his.html

Purity

96.70

Smiles

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

Molecular Formula

51673 (Gene_ID) Q9BW30 (M1-K176) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Hypoxanthine-guanine phosphoribosyltransferase
E15113d 96 Tests

ELISA Kit For Hypoxanthine-guanine phosphoribosyltransferase

Sign In for Pricing
View Details
Lentiviral human SLC25A39 shRNA (UAS) - Lentiviral human SLC25A39 shRNA (UAS, iRFP) plasmid
GTR15116236 1 Vial

Lentiviral human SLC25A39 shRNA (UAS) - Lentiviral human SLC25A39 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
FERMT1 Antibody
A68616-50UG 50 µg

FERMT1 Antibody

Sign In for Pricing
View Details
WRB (G-1) HRP
sc-393597 HRP 200 µg/mL

WRB (G-1) HRP

Sign In for Pricing
View Details
Rabbit Monoclonal Golgi Complex Antibody (GLG1/2829R) [Alexa Fluor 594]
NBP3-08396AF594 100 µL

Rabbit Monoclonal Golgi Complex Antibody (GLG1/2829R) [Alexa Fluor 594]

Sign In for Pricing
View Details
Acox2 Mouse qPCR Template Standard (NM_053115)
MK201172 1 Kit

Acox2 Mouse qPCR Template Standard (NM_053115)

Sign In for Pricing
View Details