Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRAP2 Antibody
MBS5312489-01 0.1 mL

GRAP2 Antibody

Sign In for Pricing
View Details
GRAP2 Antibody
MBS5312489-02 5x 0.1 mL

GRAP2 Antibody

Sign In for Pricing
View Details
N-[3- (2-Furyl) acryloyl]-Phe-Gly-Gly, 97%
GL0193-1g 1 g

N-[3- (2-Furyl) acryloyl]-Phe-Gly-Gly, 97%

Sign In for Pricing
View Details
Human Hepatitis B Virus e Antigen, HBeAg ELISA Kit
NSL2693Hu 96 Tests

Human Hepatitis B Virus e Antigen, HBeAg ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-6735-5p inhibitor
HY-RI02028-01 5 nmol

Hsa-miR-6735-5p inhibitor

Sign In for Pricing
View Details
Hsa-miR-6735-5p inhibitor
HY-RI02028-02 20 nmol

Hsa-miR-6735-5p inhibitor

Sign In for Pricing
View Details