Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Netrin G1 (NTNG1) (NM_014917) Human Over-expression Lysate
LY414925 100 µg

Netrin G1 (NTNG1) (NM_014917) Human Over-expression Lysate

Sign In for Pricing
View Details
TSPAN33 Recombinant Protein (Mouse)
RP181808 100 µg

TSPAN33 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse 1700071K01Rik shRNA (UAS) - Lentiviral mouse 1700071K01Rik shRNA (UAS) (25)
GTR15234377 1 Vial

Lentiviral mouse 1700071K01Rik shRNA (UAS) - Lentiviral mouse 1700071K01Rik shRNA (UAS) (25)

Sign In for Pricing
View Details
Lentiviral mouse Cfdp1 shRNA (UAS) - Lentiviral mouse Cfdp1 shRNA (UAS, RFP) plasmid
GTR15216985 1 Vial

Lentiviral mouse Cfdp1 shRNA (UAS) - Lentiviral mouse Cfdp1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Timm29 Polyclonal Antibody
MBS2575012-01 0.06 mL

Timm29 Polyclonal Antibody

Sign In for Pricing
View Details
Timm29 Polyclonal Antibody
MBS2575012-02 0.12 mL

Timm29 Polyclonal Antibody

Sign In for Pricing
View Details