Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT8P14 sgRNA CRISPR Lentivector set (Human)
K1167201 3x 1.0 µg

KRT8P14 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Artificial Sweat (Acid, ISO 3160-2)
H2472 500 mL

Artificial Sweat (Acid, ISO 3160-2)

Sign In for Pricing
View Details
KRISHZYME™ Nadroparin Factor IIa Assay Kit
KBBA03N 2x 96 Well

KRISHZYME™ Nadroparin Factor IIa Assay Kit

Sign In for Pricing
View Details
Antiquitin (C-4)
sc-365642 200 µg/mL

Antiquitin (C-4)

Sign In for Pricing
View Details
RPL12P31 3'UTR GFP Stable Cell Line
TU070724 1.0 mL

RPL12P31 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MYO5A Antibody
A33419-100UG 100 µg

MYO5A Antibody

Sign In for Pricing
View Details