Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (MaxLight 490)
MBS6207594-01 0.1 mL

NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (MaxLight 490)

Sign In for Pricing
View Details
NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (MaxLight 490)
MBS6207594-02 5x 0.1 mL

NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (MaxLight 490)

Sign In for Pricing
View Details
PARP14 Human siRNA Oligo Duplex (Locus ID 54625)
SR310178 1 Kit

PARP14 Human siRNA Oligo Duplex (Locus ID 54625)

Sign In for Pricing
View Details
HyHEL-10 Human IgM Isotype Control, In Vivo Grade Recombinant Human discontinued
587133 1 mg

HyHEL-10 Human IgM Isotype Control, In Vivo Grade Recombinant Human discontinued

Sign In for Pricing
View Details
CD155, PVR (Polio Virus Receptor) (BSA & Azide Free) (MaxLight 490) discontinued
C2548-85X-ML490 100 µL

CD155, PVR (Polio Virus Receptor) (BSA & Azide Free) (MaxLight 490) discontinued

Sign In for Pricing
View Details
CP-609754
MBS5785319 Inquire

CP-609754

Sign In for Pricing
View Details