Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD55 Antibody
V8777-100UG 100 µg

CD55 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Adrenal gland
CS618417 5x 5 µm

Frozen Tissue Sections, Adrenal gland

Sign In for Pricing
View Details
Klra17 Protein Vector (Mouse) (pPB-C-His)
PV194922 500 ng

Klra17 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
BORIS (CTCFL) Human Gene Knockout Kit (CRISPR)
KN216042RB 1 Kit

BORIS (CTCFL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tetraisopropyl Dichloromethylene Diphosphonate
sc-220223 50 mg

Tetraisopropyl Dichloromethylene Diphosphonate

Sign In for Pricing
View Details
LENG9 antibody
70R-18249 50 ul

LENG9 antibody

Sign In for Pricing
View Details