Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RalA Binding Protein 1 (RALBP1)
142070 200 µL

RalA Binding Protein 1 (RALBP1)

Sign In for Pricing
View Details
Young Slits
1111241 1 Each

Young Slits

Sign In for Pricing
View Details
Recombinant Human EIF4E2 Protein
E30P6793 20 µg

Recombinant Human EIF4E2 Protein

Sign In for Pricing
View Details
QuantumPlex™ - Carboxyl - 4.4µm - 5 populations
235A 2x 7 mL - 280 Tests

QuantumPlex™ - Carboxyl - 4.4µm - 5 populations

Sign In for Pricing
View Details
Human CNTN3 Protein, Fc Tag
KMPH1298 50 µg

Human CNTN3 Protein, Fc Tag

Sign In for Pricing
View Details
(1R,2R)-2-Aminocyclopentanecarboxylic acid hydrochloride
TRC-A938150-100MG 100 mg

(1R,2R)-2-Aminocyclopentanecarboxylic acid hydrochloride

Sign In for Pricing
View Details