Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trappc6b 3'UTR GFP Stable Cell Line
TU272397 1.0 mL

Trappc6b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum rpsI Protein (aa 1-130) (strain Okra / Type B1)
VAng-Lsx8690-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Botulinum rpsI Protein (aa 1-130) (strain Okra / Type B1)

Sign In for Pricing
View Details
ANKT CRISPR/Cas9 KO Plasmid (h)
sc-412145 20 µg

ANKT CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal Fibronectin Antibody [Dylight 755]
NBP1-91258IR 0.1 mL

Rabbit Polyclonal Fibronectin Antibody [Dylight 755]

Sign In for Pricing
View Details
HPLC Column, C8-Universal,3μm,120Å,2.1x250mm
13011299 1 PC

HPLC Column, C8-Universal,3μm,120Å,2.1x250mm

Sign In for Pricing
View Details
C1GALT1 (F-31) : m-IgG Fc BP-HRP Bundle
sc-537285 1 Kit

C1GALT1 (F-31) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details