Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep ADP-ribosylation factor 5 (ARF5) ELISA Kit
MBS7204052-01 48 Well

Sheep ADP-ribosylation factor 5 (ARF5) ELISA Kit

Sign In for Pricing
View Details
Sheep ADP-ribosylation factor 5 (ARF5) ELISA Kit
MBS7204052-02 96 Well

Sheep ADP-ribosylation factor 5 (ARF5) ELISA Kit

Sign In for Pricing
View Details
Sheep ADP-ribosylation factor 5 (ARF5) ELISA Kit
MBS7204052-03 5x 96 Well

Sheep ADP-ribosylation factor 5 (ARF5) ELISA Kit

Sign In for Pricing
View Details
Sheep ADP-ribosylation factor 5 (ARF5) ELISA Kit
MBS7204052-04 10x 96 Well

Sheep ADP-ribosylation factor 5 (ARF5) ELISA Kit

Sign In for Pricing
View Details
Arhgap15 (NM_001013917) Rat Tagged ORF Clone Lentiviral Particle
RR213766L4V 200 µL

Arhgap15 (NM_001013917) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DGAT1 (Diacylglycerol O-acyltransferase 1, ARGP1, DGAT, ACAT Related Gene Product 1, ARAT, DIAR7) (HRP).
MBS6446111-01 0.1 mL

DGAT1 (Diacylglycerol O-acyltransferase 1, ARGP1, DGAT, ACAT Related Gene Product 1, ARAT, DIAR7) (HRP).

Sign In for Pricing
View Details