Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AP2M1/Ap 2 Mu 1 Rabbit Monoclonal Antibody
MBS1750074-01 0.03 mL

Anti-AP2M1/Ap 2 Mu 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-AP2M1/Ap 2 Mu 1 Rabbit Monoclonal Antibody
MBS1750074-02 0.1 mL

Anti-AP2M1/Ap 2 Mu 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-AP2M1/Ap 2 Mu 1 Rabbit Monoclonal Antibody
MBS1750074-03 5x 0.1 mL

Anti-AP2M1/Ap 2 Mu 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-MTCH2 Rabbit pAb
GB113861 100 μL

Anti-MTCH2 Rabbit pAb

Sign In for Pricing
View Details
Difelikefalin Impurity 69
RM-D281069-01 10 mg

Difelikefalin Impurity 69

Sign In for Pricing
View Details
Difelikefalin Impurity 69
RM-D281069-02 100 mg

Difelikefalin Impurity 69

Sign In for Pricing
View Details