Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC685356 3'UTR Luciferase Stable Cell Line
TU211233 1.0 mL

LOC685356 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PET117 (NM_001164811) Human Tagged ORF Clone Lentiviral Particle
RC228028L4V 200 µL

PET117 (NM_001164811) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Anti-MAP2 antibody
SL20265R-01 50 µL

Rabbit Anti-MAP2 antibody

Sign In for Pricing
View Details
Rabbit Anti-MAP2 antibody
SL20265R-02 100 µL

Rabbit Anti-MAP2 antibody

Sign In for Pricing
View Details
7-(beta-D-Glucopyranosyloxy)-8-Hydroxy-2H-1-Benzopyran-2-One
TRC-G401140-250MG 250 mg

7-(beta-D-Glucopyranosyloxy)-8-Hydroxy-2H-1-Benzopyran-2-One

Sign In for Pricing
View Details
GIGYF1 (NM_022574) Human Untagged Clone
SC318456 10 µg

GIGYF1 (NM_022574) Human Untagged Clone

Sign In for Pricing
View Details