Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RO60 (NM_001042370) Human Recombinant Protein
TP306071M 100 µg

RO60 (NM_001042370) Human Recombinant Protein

Sign In for Pricing
View Details
TTC12 Protein Vector (Rat) (pPB-C-His)
PV313474 500 ng

TTC12 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Triiodothyronine (T3) (HRP) discontinued
T8425-01G-HRP 100 µL

Triiodothyronine (T3) (HRP) discontinued

Sign In for Pricing
View Details
HMPV-F Protein (C-His, HMPV)
P520182 100 µg

HMPV-F Protein (C-His, HMPV)

Sign In for Pricing
View Details
ADH4 (Alcohol Dehydrogenase 4, Alcohol Dehydrogenase Class II pi Chain) (FITC)
123007-FITC 100 µL

ADH4 (Alcohol Dehydrogenase 4, Alcohol Dehydrogenase Class II pi Chain) (FITC)

Sign In for Pricing
View Details
Lentiviral human TIMM10 shRNA (UAS) - Lentiviral human TIMM10 shRNA (UAS, GFP) (100)
GTR15344568 1 Vial

Lentiviral human TIMM10 shRNA (UAS) - Lentiviral human TIMM10 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details