Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOPSO Buffer 99% Extrapure
01767 00050 50 g

MOPSO Buffer 99% Extrapure

Sign In for Pricing
View Details
Galectin-4 (LGALS4, Galectin 4, Gal-4, Antigen NY-CO-27, L-36 Lactose-binding Protein, L36LBP, Lactose-binding Lectin 4)
316756-01 50 µg

Galectin-4 (LGALS4, Galectin 4, Gal-4, Antigen NY-CO-27, L-36 Lactose-binding Protein, L36LBP, Lactose-binding Lectin 4)

Sign In for Pricing
View Details
Galectin-4 (LGALS4, Galectin 4, Gal-4, Antigen NY-CO-27, L-36 Lactose-binding Protein, L36LBP, Lactose-binding Lectin 4)
316756-02 100 µg

Galectin-4 (LGALS4, Galectin 4, Gal-4, Antigen NY-CO-27, L-36 Lactose-binding Protein, L36LBP, Lactose-binding Lectin 4)

Sign In for Pricing
View Details
Mouse Fam120b activation kit by CRISPRa
GA207389 1 Kit

Mouse Fam120b activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal ZBTB7A/Pokemon Antibody [Alexa Fluor 405]
NB100-761AF405 0.1 mL

Rabbit Polyclonal ZBTB7A/Pokemon Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
H1FX sgRNA CRISPR Lentivector (Human) (Target 2)
K0924603 1.0 µg DNA

H1FX sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details