Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Avium rplN Protein (aa 1-122)
VAng-Lsx4070-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Avium rplN Protein (aa 1-122)

Sign In for Pricing
View Details
Recombinant Mouse VCL / Vinculin Protein (His tag)
E53A07128 50 µg

Recombinant Mouse VCL / Vinculin Protein (His tag)

Sign In for Pricing
View Details
Anti-Phospho-AXL-Y702 antibody
STJ11100989 100 µl

Anti-Phospho-AXL-Y702 antibody

Sign In for Pricing
View Details
Recombinant Rat HSD17B4 Protein, His (Fc)-Avi-tagged
HSD17B4-2583R 50 µg

Recombinant Rat HSD17B4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Anti-Human MSLN Antibody (SAA0145), APC
HC496137-01 1 Each

Anti-Human MSLN Antibody (SAA0145), APC

Sign In for Pricing
View Details
Anti-Human MSLN Antibody (SAA0145), APC
HC496137-02 100 Tests

Anti-Human MSLN Antibody (SAA0145), APC

Sign In for Pricing
View Details