Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASPR Double Nickase Plasmid (h)
sc-402760-NIC 20 µg

CASPR Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Rat Angiopoietin 4 (ANG-4) ELISA Kit
QY-E10975 96 Tests

Rat Angiopoietin 4 (ANG-4) ELISA Kit

Sign In for Pricing
View Details
Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody [Clone ID: CHYH2]
DM1036 500 µg

Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody [Clone ID: CHYH2]

Sign In for Pricing
View Details
Human Krueppel-like factor 10, KLF10 ELISA KIT
ELI-02393h 96 Tests

Human Krueppel-like factor 10, KLF10 ELISA KIT

Sign In for Pricing
View Details
Arhgef25 (NM_199395) Rat Tagged ORF Clone Lentiviral Particle
RR206852L3V 200 µL

Arhgef25 (NM_199395) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPP) (NM_001632) Human Untagged Clone
SC119167 10 µg

Alkaline Phosphatase (ALPP) (NM_001632) Human Untagged Clone

Sign In for Pricing
View Details