Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-500 1x 500 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF405S conjugate, 0.1mg/mL
BNC040918-100 1x 100 µL

CD44 Standard (HCAM/918), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF647 conjugate, 0.1mg/mL
BNC472053-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF740 conjugate, 0.1mg/mL
BNC741138-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details