Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (His-SUMO)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-his-sumo.html

Purity

92.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 36 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHC2 Protein Vector (Rat) (pPM-C-His)
PV293717 500 ng

PHC2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CHI3L1 (Chitinase-3-like Protein 1, 39kD Synovial Protein, Cartilage Glycoprotein 39, CGP-39, GP-39, hCGP-39, YKL-40) (MaxLight 550)
124941-ML550 100 µL

CHI3L1 (Chitinase-3-like Protein 1, 39kD Synovial Protein, Cartilage Glycoprotein 39, CGP-39, GP-39, hCGP-39, YKL-40) (MaxLight 550)

Sign In for Pricing
View Details
Ki-67 (Antigen Identified by Monoclonal Antibody Ki-67, KIA, MKI67, Proliferation Related Ki-67 Antigen) discontinued
K1700-07B 100 µL

Ki-67 (Antigen Identified by Monoclonal Antibody Ki-67, KIA, MKI67, Proliferation Related Ki-67 Antigen) discontinued

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Putative T-box protein 11 (tbx-11)
MBS1316034-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Putative T-box protein 11 (tbx-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Putative T-box protein 11 (tbx-11)
MBS1316034-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Putative T-box protein 11 (tbx-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Putative T-box protein 11 (tbx-11)
MBS1316034-03 0.1 mg (E-Coli)

Recombinant Caenorhabditis elegans Putative T-box protein 11 (tbx-11)

Sign In for Pricing
View Details