Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HMGCS1 Antibody [mFluor Violet 500 SE]
NBP2-97737MFV500 0.1 mL

Rabbit Polyclonal HMGCS1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Anti-Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3)
FY-AB46042-01 1 mL

Anti-Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3)

Sign In for Pricing
View Details
Anti-Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3)
FY-AB46042-02 100 µL

Anti-Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3)

Sign In for Pricing
View Details
Anti-Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3)
FY-AB46042-03 200 µL

Anti-Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3)

Sign In for Pricing
View Details
AChE/MAO-B-IN-6
HY-157090 1 Each

AChE/MAO-B-IN-6

Sign In for Pricing
View Details
Lentiviral mouse Cnnm2 shRNA (UAS) - Lentiviral mouse Cnnm2 shRNA (UAS, RFP) plasmid
GTR15198877 1 Vial

Lentiviral mouse Cnnm2 shRNA (UAS) - Lentiviral mouse Cnnm2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details