Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfide:quinone Oxidoreductase, mitochondrial, Recombinant, Schizosaccharomyces pombe, aa25-459, His-Tag
586420-01 20 µg

Sulfide:quinone Oxidoreductase, mitochondrial, Recombinant, Schizosaccharomyces pombe, aa25-459, His-Tag

Sign In for Pricing
View Details
Sulfide:quinone Oxidoreductase, mitochondrial, Recombinant, Schizosaccharomyces pombe, aa25-459, His-Tag
586420-02 100 µg

Sulfide:quinone Oxidoreductase, mitochondrial, Recombinant, Schizosaccharomyces pombe, aa25-459, His-Tag

Sign In for Pricing
View Details
Tbc1d24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4582606 1.0 µg DNA

Tbc1d24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (FITC)
MBS6147640-01 0.1 mL

HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (FITC)

Sign In for Pricing
View Details
HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (FITC)
MBS6147640-02 5x 0.1 mL

HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (FITC)

Sign In for Pricing
View Details
TRNAQ54P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV753682 1.0 µg DNA

TRNAQ54P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details