Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SR-AI/MSR Antibody [Janelia Fluor 549]
NBP1-00092JF549 0.1 mL

Rabbit Polyclonal SR-AI/MSR Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
AP3M1 (NM_012095) Human Over-expression Lysate
LC415982 20 µg

AP3M1 (NM_012095) Human Over-expression Lysate

Sign In for Pricing
View Details
pCDNA3-Flag mTOR Plasmid
PVT14613 2 µg

pCDNA3-Flag mTOR Plasmid

Sign In for Pricing
View Details
3,5-Bis (tert-butyldimethylsiloxyl) benzoic Acid Methyl Ester
160792 500 mg

3,5-Bis (tert-butyldimethylsiloxyl) benzoic Acid Methyl Ester

Sign In for Pricing
View Details
Rat Phosphatidylinositol-4-Phosphate 5-Kinase Type-1 Gamma (PIP5K1G) ELISA Kit
MBS9393853-01 48 Well

Rat Phosphatidylinositol-4-Phosphate 5-Kinase Type-1 Gamma (PIP5K1G) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphatidylinositol-4-Phosphate 5-Kinase Type-1 Gamma (PIP5K1G) ELISA Kit
MBS9393853-02 96 Well

Rat Phosphatidylinositol-4-Phosphate 5-Kinase Type-1 Gamma (PIP5K1G) ELISA Kit

Sign In for Pricing
View Details