Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Nitroprusside 99% AR
02468 00500 500 g

Sodium Nitroprusside 99% AR

Sign In for Pricing
View Details
WZ8040 5mg
A10992-5 5 mg

WZ8040 5mg

Sign In for Pricing
View Details
Lmo1 Rat shRNA Lentiviral Particle (Locus ID 245979)
TL713018V 500 µL Each

Lmo1 Rat shRNA Lentiviral Particle (Locus ID 245979)

Sign In for Pricing
View Details
Hepcidin, pro, Human, Control Peptide (Pro Hepc, LEAP, Hepatic Bactericidal Protein, Liver Expressed Antimicrobial Peptide) Control Peptide
H2009-02B 100 µg

Hepcidin, pro, Human, Control Peptide (Pro Hepc, LEAP, Hepatic Bactericidal Protein, Liver Expressed Antimicrobial Peptide) Control Peptide

Sign In for Pricing
View Details
Dynein 1, Cytoplasmic, Intermediate Chain 2 (Cytoplasmic Dynein 1 Intermediate Chain 2, DYNC1I2, Cytoplasmic Dynein Intermediate Chain 2, Dynein Intermediate Chain 2 Cytosolic, DH IC-2) discontinued
D9901-50D 100 µg

Dynein 1, Cytoplasmic, Intermediate Chain 2 (Cytoplasmic Dynein 1 Intermediate Chain 2, DYNC1I2, Cytoplasmic Dynein Intermediate Chain 2, Dynein Intermediate Chain 2 Cytosolic, DH IC-2) discontinued

Sign In for Pricing
View Details
Human Enteropeptidase,PRSS7 ELISA KIT
JOT-EK5242Hu 96 wells

Human Enteropeptidase,PRSS7 ELISA KIT

Sign In for Pricing
View Details