Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Ras-GAP Antibody [DyLight 350]
NBP3-18406UV 0.1 mL

Rabbit Polyclonal Ras-GAP Antibody [DyLight 350]

Sign In for Pricing
View Details
Mouse Monoclonal Sortilin Antibody (334703) [DyLight 488]
FAB31541K 0.1 mL

Mouse Monoclonal Sortilin Antibody (334703) [DyLight 488]

Sign In for Pricing
View Details
FAS 3'UTR GFP Stable Cell Line
TU057719 1.0 mL

FAS 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Snrpb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3391607 1.0 µg DNA

Snrpb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
UNC93B1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
49191061 1.0 µg DNA

UNC93B1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CFB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV655124 1.0 µg DNA

CFB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details