Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNDC5 Antibody
E30AC1327 100 µL

TXNDC5 Antibody

Sign In for Pricing
View Details
Recombinant Human Keratinocyte Growth Factor
45106P-1000 1000ug

Recombinant Human Keratinocyte Growth Factor

Sign In for Pricing
View Details
MSH2 mouse monoclonal antibody, clone 25D12, Purified
DM332 1 mL

MSH2 mouse monoclonal antibody, clone 25D12, Purified

Sign In for Pricing
View Details
S100A7 CRISPR All-in-one AAV vector set (with saCas9)(Human)
42939151 3x 1.0 µg DNA

S100A7 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Eif4g2 Rat siRNA Oligo Duplex (Locus ID 361628)
SR509289 1 Kit

Eif4g2 Rat siRNA Oligo Duplex (Locus ID 361628)

Sign In for Pricing
View Details
Human AIRE siRNA
abx907109-01 15 nmol

Human AIRE siRNA

Sign In for Pricing
View Details