Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sterol regulatory element-binding protein 1C (SREBP-1C) ELISA Kit
YP-W28422-01 48 Tests

Mouse Sterol regulatory element-binding protein 1C (SREBP-1C) ELISA Kit

Sign In for Pricing
View Details
Mouse Sterol regulatory element-binding protein 1C (SREBP-1C) ELISA Kit
YP-W28422-02 96 Tests

Mouse Sterol regulatory element-binding protein 1C (SREBP-1C) ELISA Kit

Sign In for Pricing
View Details
Calmodulin-Dependent Protein Kinase II, alpha, beta, phosphorylated (T286/287) (CAMKII) (MaxLight 405) discontinued
C1035-25L-ML405 100 µL

Calmodulin-Dependent Protein Kinase II, alpha, beta, phosphorylated (T286/287) (CAMKII) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human AGT2 ELISA Kit
E101099 1 Each

Human AGT2 ELISA Kit

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Transmembrane Protein 27 (TMEM27)
MBS2147970-01 0.1 mL

APC-Linked Monoclonal Antibody to Transmembrane Protein 27 (TMEM27)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Transmembrane Protein 27 (TMEM27)
MBS2147970-02 0.2 mL

APC-Linked Monoclonal Antibody to Transmembrane Protein 27 (TMEM27)

Sign In for Pricing
View Details