Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tfeb (NM_001161722) Mouse Tagged ORF Clone
MR223018 10 µg

Tfeb (NM_001161722) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
St8sia2 ORF Vector (Mouse) (pORF)
45656014 1.0 µg DNA

St8sia2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Cmc1 ORF Vector (Rat) (pORF)
ORF065170 1.0 µg DNA

Cmc1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae pyrH Protein (aa 1-239)
VAng-Wyb2757-500gEcoli 500 µg (E. coli)

Recombinant Neisseria Gonorrhoeae pyrH Protein (aa 1-239)

Sign In for Pricing
View Details
Human PDZK1P1 qPCR Primer Pair
QH82469S 200 Tests

Human PDZK1P1 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Human Fibrinopeptide A Protein - (Dry Ice)
H00002243-P01-25ug 25 µg

Recombinant Human Fibrinopeptide A Protein - (Dry Ice)

Sign In for Pricing
View Details