Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CDK2 Polyclonal Antibody
HB845024-01 50 µg

Anti-CDK2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CDK2 Polyclonal Antibody
HB845024-02 100 µg

Anti-CDK2 Polyclonal Antibody

Sign In for Pricing
View Details
RAC-Gamma Serine/threonine-Protein Kinase (AKT3) Antibody
abx432305 200 µL

RAC-Gamma Serine/threonine-Protein Kinase (AKT3) Antibody

Sign In for Pricing
View Details
ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1, 16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1, XAP-3, XAP3) (HRP)
243644-HRP 100 µL

ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1, 16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1, XAP-3, XAP3) (HRP)

Sign In for Pricing
View Details
CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3)
MBS6008436-01 0.2 mL

CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3)

Sign In for Pricing
View Details
CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3)
MBS6008436-02 5x 0.2 mL

CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3)

Sign In for Pricing
View Details