Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM3 (PDZ and LIM Domain 3, ALP)
327817 100 µL

PDLIM3 (PDZ and LIM Domain 3, ALP)

Sign In for Pricing
View Details
PCDH-CMV-HLFEF1A-EGFP-T2A-PURO
BZ0993-2 1 Vial

PCDH-CMV-HLFEF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
CCDC54 Human siRNA Oligo Duplex (Locus ID 84692)
SR313631 1 Kit

CCDC54 Human siRNA Oligo Duplex (Locus ID 84692)

Sign In for Pricing
View Details
Human Pons Tissue Lysate
30R-AP033 150 ug

Human Pons Tissue Lysate

Sign In for Pricing
View Details
S100A9 Mouse Monoclonal Antibody
AMM82734-01 1 Each

S100A9 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
S100A9 Mouse Monoclonal Antibody
AMM82734-02 50 µL

S100A9 Mouse Monoclonal Antibody

Sign In for Pricing
View Details