Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lbx1 (NM_001047108) Rat Untagged Clone
RN209686 10 µg

Lbx1 (NM_001047108) Rat Untagged Clone

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TY1B-H Polyclonal Antibody
MBS7180116 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TY1B-H Polyclonal Antibody

Sign In for Pricing
View Details
Polr3gl (NM_001109571) Rat Tagged Lenti ORF Clone
RR209430L3 10 µg

Polr3gl (NM_001109571) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Formylmethionine (fMet) Monkey ELISA Kit
D4673 96 Tests

Formylmethionine (fMet) Monkey ELISA Kit

Sign In for Pricing
View Details
HLA-E Knockout A2780 Polyclonal Cells
ARG29120 1 Million

HLA-E Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
p38 (MAPK14) (NM_139012) Human Tagged ORF Clone Lentiviral Particle
RC206605L1V 200 µL

p38 (MAPK14) (NM_139012) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details