Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc39a4 (NM_001077669) Rat Tagged Lenti ORF Clone
RR200752L4 10 µg

Slc39a4 (NM_001077669) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC20A2 antibody
70R-20311 50 ul

SLC20A2 antibody

Sign In for Pricing
View Details
Maged1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4075706 1.0 µg DNA

Maged1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Tacc1 Mouse qPCR Primer Pair (NM_177089)
MP217192 200 Reactions

Tacc1 Mouse qPCR Primer Pair (NM_177089)

Sign In for Pricing
View Details
Phospho-TACC3 (Tyr560) Blocking Peptide
MBS9618524-01 1 mg

Phospho-TACC3 (Tyr560) Blocking Peptide

Sign In for Pricing
View Details
Phospho-TACC3 (Tyr560) Blocking Peptide
MBS9618524-02 5x 1 mg

Phospho-TACC3 (Tyr560) Blocking Peptide

Sign In for Pricing
View Details