Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Palmitoyl-N-isopropylamide
sc-203177 5 mg

Palmitoyl-N-isopropylamide

Sign In for Pricing
View Details
EuglobulinLysis (EL) Porcine ELISA Kit
D1290 96 Tests

EuglobulinLysis (EL) Porcine ELISA Kit

Sign In for Pricing
View Details
CGRRF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV677205 1.0 µg DNA

CGRRF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rat Slc52a2 Pre-designed siRNA Set B
SI213209B 1 Each

Rat Slc52a2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Pip5k1a (NM_001042621) Rat Tagged ORF Clone Lentiviral Particle
RR214780L3V 200 µL

Pip5k1a (NM_001042621) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Anti-Horse IgG (H&L) - Cy3
BS22062-01 100 µL

Rabbit Anti-Horse IgG (H&L) - Cy3

Sign In for Pricing
View Details