Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdia4 Mouse shRNA Lentiviral Particle (Locus ID 12304)
TL500249V 500 µL Each

Pdia4 Mouse shRNA Lentiviral Particle (Locus ID 12304)

Sign In for Pricing
View Details
Zinc Finger Protein GLIS1 (GLIS1) Antibody
abx233481 100 µg

Zinc Finger Protein GLIS1 (GLIS1) Antibody

Sign In for Pricing
View Details
Polyclonal antibody-Canine Cytochrome P450 2C41
PA-RA-07678 100 µg

Polyclonal antibody-Canine Cytochrome P450 2C41

Sign In for Pricing
View Details
IL33 (NM_033439) Human Untagged Clone
SC100114 10 µg

IL33 (NM_033439) Human Untagged Clone

Sign In for Pricing
View Details
TCP10L Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV715784 1.0 µg DNA

TCP10L Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
GSPT1 (NM_001130006) Human Tagged ORF Clone Lentiviral Particle
RC226048L4V 200 µL

GSPT1 (NM_001130006) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details