Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL26 Protein Vector (Human) (pPB-N-His)
PV022922 500 ng

KLHL26 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MAGEC2 Protein Vector (Human) (pPB-C-His)
PV024849 500 ng

MAGEC2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ompP Antibody
A78551-50UL 50 μL

ompP Antibody

Sign In for Pricing
View Details
ST8SIA4, ID (ST8SIA4, PST, PST1, SIAT8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, Alpha-2,8-sialyltransferase 8D, Polysialyltransferase-1, Sialyltransferase 8D, Sialytransferase St8Sia IV) (MaxLight 650) discontinued
042358-ML650 100 µL

ST8SIA4, ID (ST8SIA4, PST, PST1, SIAT8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, Alpha-2,8-sialyltransferase 8D, Polysialyltransferase-1, Sialyltransferase 8D, Sialytransferase St8Sia IV) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Hspa9 sgRNA CRISPR Lentivector set (Mouse)
K4822801 3x 1.0 µg

Hspa9 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
SC5AC rabbit pAb
ES13190-01 50 µL

SC5AC rabbit pAb

Sign In for Pricing
View Details