Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLITRK4, CT (SLITRK4, SLIT and NTRK-like protein 4) (MaxLight 750) discontinued
042011-ML750 100 µL

SLITRK4, CT (SLITRK4, SLIT and NTRK-like protein 4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Human KLB Protein
E30P12468 20 µg

Recombinant Human KLB Protein

Sign In for Pricing
View Details
MicglutaXL Dubecco’s Modified Eagle Medium (DMEM) w/ 4.5gms Glucose per litre, L-Alanyl-L-Glutamine, 2.5mM HEPES buffer and Sodium bicarbonate w/o Sodium Pyruvate
AL1067G-01 500 mL

MicglutaXL Dubecco’s Modified Eagle Medium (DMEM) w/ 4.5gms Glucose per litre, L-Alanyl-L-Glutamine, 2.5mM HEPES buffer and Sodium bicarbonate w/o Sodium Pyruvate

Sign In for Pricing
View Details
MicglutaXL Dubecco’s Modified Eagle Medium (DMEM) w/ 4.5gms Glucose per litre, L-Alanyl-L-Glutamine, 2.5mM HEPES buffer and Sodium bicarbonate w/o Sodium Pyruvate
AL1067G-02 2x 500 mL

MicglutaXL Dubecco’s Modified Eagle Medium (DMEM) w/ 4.5gms Glucose per litre, L-Alanyl-L-Glutamine, 2.5mM HEPES buffer and Sodium bicarbonate w/o Sodium Pyruvate

Sign In for Pricing
View Details
MicglutaXL Dubecco’s Modified Eagle Medium (DMEM) w/ 4.5gms Glucose per litre, L-Alanyl-L-Glutamine, 2.5mM HEPES buffer and Sodium bicarbonate w/o Sodium Pyruvate
AL1067G-03 6x 500 mL

MicglutaXL Dubecco’s Modified Eagle Medium (DMEM) w/ 4.5gms Glucose per litre, L-Alanyl-L-Glutamine, 2.5mM HEPES buffer and Sodium bicarbonate w/o Sodium Pyruvate

Sign In for Pricing
View Details
MicglutaXL Dubecco’s Modified Eagle Medium (DMEM) w/ 4.5gms Glucose per litre, L-Alanyl-L-Glutamine, 2.5mM HEPES buffer and Sodium bicarbonate w/o Sodium Pyruvate
AL1067G-04 20x 500 mL

MicglutaXL Dubecco’s Modified Eagle Medium (DMEM) w/ 4.5gms Glucose per litre, L-Alanyl-L-Glutamine, 2.5mM HEPES buffer and Sodium bicarbonate w/o Sodium Pyruvate

Sign In for Pricing
View Details