Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMNN Recombinant Protein
32-3895-20 20 µg

GMNN Recombinant Protein

Sign In for Pricing
View Details
ELAC2 Rabbit Polyclonal Antibody
TA356136 100 µL

ELAC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Collagen XI α1/COL11A1 Polyclonal Antibody
PAV6222 100 μL

Rabbit Anti-Collagen XI α1/COL11A1 Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB1 Adenovirus (Mouse)
50683054 1.0 mL

ZBTB1 Adenovirus (Mouse)

Sign In for Pricing
View Details
TTC39DP Adenovirus (Human)
48699051 1.0 mL

TTC39DP Adenovirus (Human)

Sign In for Pricing
View Details
OR4K17 (Olfactory Receptor 4K17, Olfactory Receptor OR14-29, OR4K17) (MaxLight 405) discontinued
302624-ML405 100 µL

OR4K17 (Olfactory Receptor 4K17, Olfactory Receptor OR14-29, OR4K17) (MaxLight 405) discontinued

Sign In for Pricing
View Details