Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trdn 3'UTR GFP Stable Cell Line
TU171050 1.0 mL

Trdn 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Fhad1 Rat siRNA Oligo Duplex (Locus ID 500577)
SR511002 1 Kit

Fhad1 Rat siRNA Oligo Duplex (Locus ID 500577)

Sign In for Pricing
View Details
PLV3-U6-NXPH4-shRNA3-CopGFP-Puro Plasmid
PVT81786 2 µg

PLV3-U6-NXPH4-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
FAU (Ubiquitin-like Protein FUBI) (FITC) discontinued
F0020-20C-FITC 200 µL

FAU (Ubiquitin-like Protein FUBI) (FITC) discontinued

Sign In for Pricing
View Details
Cystatin B Blocking Peptide
CBP1289-01 1 mg

Cystatin B Blocking Peptide

Sign In for Pricing
View Details
Cystatin B Blocking Peptide
CBP1289-02 5 mg

Cystatin B Blocking Peptide

Sign In for Pricing
View Details