Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat NFKB Activating Protein (NKAP) ELISA Kit
RD-NKAP-Ra-48Tests 48 Tests

Rat NFKB Activating Protein (NKAP) ELISA Kit

Sign In for Pricing
View Details
Human CD163 Antibody , PerCP
E55A09719 50 Tests

Human CD163 Antibody , PerCP

Sign In for Pricing
View Details
Smyd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6484105 3x 1.0 µg

Smyd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
FKBPL Rabbit Polyclonal Antibody
TA344698 100 µL

FKBPL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Necab3 Mouse shRNA Plasmid (Locus ID 56846)
TL503273 1 Kit

Necab3 Mouse shRNA Plasmid (Locus ID 56846)

Sign In for Pricing
View Details
Mouse RING finger protein 183, RNF183 ELISA Kit
MBS9341206-01 48 Well

Mouse RING finger protein 183, RNF183 ELISA Kit

Sign In for Pricing
View Details