Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COG2 Recombinant Protein (Rat)
RP195746 100 µg

COG2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
FITC*Anti Duck IgY
MBS9526186-01 0.1 mL

FITC*Anti Duck IgY

Sign In for Pricing
View Details
FITC*Anti Duck IgY
MBS9526186-02 5x 0.1 mL

FITC*Anti Duck IgY

Sign In for Pricing
View Details
MT1F (NM_005949) Human Tagged ORF Clone
RC205931 10 µg

MT1F (NM_005949) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human MRGPRF Alexa Fluor 405 Antibody (Clone 916219)
FAB8396V-100UG 100 µg

Human MRGPRF Alexa Fluor 405 Antibody (Clone 916219)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)
MBS2054217-01 0.1 mL

FITC-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)

Sign In for Pricing
View Details