Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUX1 polyclonal antibody
BS78299-01 50 µL

CUX1 polyclonal antibody

Sign In for Pricing
View Details
CUX1 polyclonal antibody
BS78299-02 100 µL

CUX1 polyclonal antibody

Sign In for Pricing
View Details
4-Chloro-1,2-dihydro-5-acenaphthylenamine
TRC-C370050-5MG 5 mg

4-Chloro-1,2-dihydro-5-acenaphthylenamine

Sign In for Pricing
View Details
Sardh (NM_138665) Mouse Tagged Lenti ORF Clone
MR211181L4 10 µg

Sardh (NM_138665) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LMTK3 Rabbit Polyclonal Antibody
E53P04767 100 µL

LMTK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adarb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4097106 1.0 µg DNA

Adarb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details