Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-rat-hek293-his.html

Purity

95.0

Smiles

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Molecular Formula

295322 (Gene_ID) Q501W4 (F29-S256) (Accession)

Molecular Weight

Approximately 42-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG3 (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (Azide free) (HRP)
MBS6276077-01 0.2 mL

ATG3 (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (Azide free) (HRP)

Sign In for Pricing
View Details
ATG3 (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (Azide free) (HRP)
MBS6276077-02 5x 0.2 mL

ATG3 (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (Azide free) (HRP)

Sign In for Pricing
View Details
Anti-FLJ11184  (4A6)
YF-MA18768 100 ug

Anti-FLJ11184 (4A6)

Sign In for Pricing
View Details
2- (2-bromo-4-oxo-4H-cyclopenta[b]thiophen-6 (5H) -ylidene) malononitrile
JH915033 1 Each

2- (2-bromo-4-oxo-4H-cyclopenta[b]thiophen-6 (5H) -ylidene) malononitrile

Sign In for Pricing
View Details
Lentiviral human NAPG shRNA (UAS) - Lentiviral human NAPG shRNA (UAS) (100)
GTR15132126 1 Vial

Lentiviral human NAPG shRNA (UAS) - Lentiviral human NAPG shRNA (UAS) (100)

Sign In for Pricing
View Details
Mouse Glucokinase (GCK) ELISA Kit
RD-GCK-Mu-01 96 Tests

Mouse Glucokinase (GCK) ELISA Kit

Sign In for Pricing
View Details