Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 2a/IFNA2, Human (R46K)

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion[3]. IFN-alpha 2a/IFNA2 Protein, Human (C24-E188, R46K) contains 165 a.a., is produced in E. coli with tag free.

Product Specifications

Product Name Alternative

IFN-alpha 2a/IFNA2 Protein, Human (R46K), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-2a-protein-human.html

Purity

98.0

Smiles

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Molecular Formula

3440 (Gene_ID) P01563 (C24-E188, R46K) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Gerasymenko IM, et al. MULTIPLEX PCR ASSAY FOR DETECTION OF HUMAN SOMATOTROPIN AND INTERFERON ALPHA2b GENES IN PLANT MATERIAL. Tsitol Genet. 2015 May-Jun;49 (3) :3-8.|[2]Chang CH, et al. A new method to produce monoPEGylated dimeric cytokines shown with human interferon-α2b. Bioconjug Chem. 2009 Oct 21;20 (10) :1899-907.|[3]Abraham S, et al. Gene therapy with plasmids encoding IFN-β or IFN-α14 confers long-term resistance to HIV-1 in humanized mice. Oncotarget. 2016 Nov 29;7 (48) :78412-78420.|[4]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[5]Sutter K, et al. Interferon α subtypes in HIV infection. Cytokine Growth Factor Rev. 2018 Apr;40:13-18.|[6]Watanabe H, et al. Detailed structure of mouse interferon α2 and its interaction with Sortilin. J Biochem. 2021 Oct 11;170 (2) :265-273.|[7]Gull I, et al. Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b. Springerplus. 2013 Jun 15;2 (1) :264.|[8]Paul F, et al. IFNA2: The prototypic human alpha interferon. Gene. 2015 Aug 10;567 (2) :132-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike S1 RBD Protein, Human Fc-Fusion, Avi-Tag
E80025 100 µg

SARS-CoV-2 Spike S1 RBD Protein, Human Fc-Fusion, Avi-Tag

Sign In for Pricing
View Details
CCDC148 Rabbit Polyclonal Antibody
orb3071425-01 30 µL

CCDC148 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC148 Rabbit Polyclonal Antibody
orb3071425-02 50 µL

CCDC148 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC148 Rabbit Polyclonal Antibody
orb3071425-03 100 µL

CCDC148 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC148 Rabbit Polyclonal Antibody
orb3071425-04 200 µL

CCDC148 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Amyloid Precursor Protein Rabbit Polyclonal Antibody (PerCP)
orb1604985 100 µL

Amyloid Precursor Protein Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details