Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF706 Rabbit Polyclonal Antibody
TA329913 100 µL

ZNF706 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal A4GNT Antibody
NBP1-89129 0.1 mL

Rabbit Polyclonal A4GNT Antibody

Sign In for Pricing
View Details
Human Beta2 - GP1 IgA/G/M ELISA Kit
EHB0652 96 Tests

Human Beta2 - GP1 IgA/G/M ELISA Kit

Sign In for Pricing
View Details
Adducin, alpha (Alpha-adducin, Erythrocyte Adducin Subunit alpha, ADD1, ADDA) discontinued
A0859-55S 50 µL

Adducin, alpha (Alpha-adducin, Erythrocyte Adducin Subunit alpha, ADD1, ADDA) discontinued

Sign In for Pricing
View Details
TSPAN19 Human qPCR Primer Pair (NM_001100917)
HP204659 200 Reactions

TSPAN19 Human qPCR Primer Pair (NM_001100917)

Sign In for Pricing
View Details
Recombinant Mouse Growth Hormone/GH
32-7041-10 10 µg

Recombinant Mouse Growth Hormone/GH

Sign In for Pricing
View Details