Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM133A, NT (FAM133A, Protein FAM133A) (PE) discontinued
035383-PE 200 µL

FAM133A, NT (FAM133A, Protein FAM133A) (PE) discontinued

Sign In for Pricing
View Details
GDNF family Receptor α-2 (GFRA2) Bovine ELISA Kit
D6606 96 Tests

GDNF family Receptor α-2 (GFRA2) Bovine ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-CDC26 Polyclonal Antibody
PAV5856 100 μL

Rabbit Anti-CDC26 Polyclonal Antibody

Sign In for Pricing
View Details
Chrna4 (NM_015730) Mouse Tagged Lenti ORF Clone
MR209587L3 10 µg

Chrna4 (NM_015730) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Met Protein Vector (Human) (pPB-C-His)
PV093898 500 ng

Met Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
SFXN2 3'UTR Lenti-reporter-Luc Vector
43615081 1.0 µg

SFXN2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details