Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEAF6 CRISPR Activation Plasmid (h)
sc-408420-ACT 20 µg

MEAF6 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Human PPFIBP2 Knockout HEK293T cell line
GTR15411815 1 Vial

Human PPFIBP2 Knockout HEK293T cell line

Sign In for Pricing
View Details
HS6ST1 (NM_004807) Human Untagged Clone
SC317658 10 µg

HS6ST1 (NM_004807) Human Untagged Clone

Sign In for Pricing
View Details
Pcdhb10 (NM_053135) Mouse Tagged ORF Clone
MR214414 10 µg

Pcdhb10 (NM_053135) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SBDSP1 Human qPCR Primer Pair (NR_001588)
HP219960 200 Reactions

SBDSP1 Human qPCR Primer Pair (NR_001588)

Sign In for Pricing
View Details
Mouse Anti-Human Lambda (lambda chain)-Biotin Conjugate Antibody
MBS4152423-01 0.1 mg

Mouse Anti-Human Lambda (lambda chain)-Biotin Conjugate Antibody

Sign In for Pricing
View Details