Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCED1A Knockout Hela Polyclonal Cells
ARG8624 1 Million

PCED1A Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral human FLNA shRNA (UAS) - Lentiviral human FLNA shRNA (UAS, RFP) plasmid
GTR15308884 1 Vial

Lentiviral human FLNA shRNA (UAS) - Lentiviral human FLNA shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
FOXO3 (NM_201559) Human Recombinant Protein
TP302894L 1 mg

FOXO3 (NM_201559) Human Recombinant Protein

Sign In for Pricing
View Details
α-Monomyristin
TRC-M566560-250MG 250 mg

α-Monomyristin

Sign In for Pricing
View Details
Eukaryotic Translation Initiation Factor 1AY (EIF1AY) BioAssayTM ELISA Kit (Human)
517185 96 Tests

Eukaryotic Translation Initiation Factor 1AY (EIF1AY) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Hsa-miR-193b-3p miRNA Inhibitor
CIH0250-01 10 nmol

Hsa-miR-193b-3p miRNA Inhibitor

Sign In for Pricing
View Details