Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psg25 (NM_054060) Mouse Tagged ORF Clone
MG207623 10 µg

Psg25 (NM_054060) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
OR9I1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1548104 1.0 µg DNA

OR9I1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Protein MROH8 (MROH8) Antibody (HRP)
abx349043-01 50 µL

Protein MROH8 (MROH8) Antibody (HRP)

Sign In for Pricing
View Details
Protein MROH8 (MROH8) Antibody (HRP)
abx349043-02 100 µL

Protein MROH8 (MROH8) Antibody (HRP)

Sign In for Pricing
View Details
Protein MROH8 (MROH8) Antibody (HRP)
abx349043-03 200 µL

Protein MROH8 (MROH8) Antibody (HRP)

Sign In for Pricing
View Details
Protein MROH8 (MROH8) Antibody (HRP)
abx349043-04 1 mL

Protein MROH8 (MROH8) Antibody (HRP)

Sign In for Pricing
View Details