Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGA Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV672192 1.0 µg DNA

FGA Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TEX12 (NM_031275) Human Tagged Lenti ORF Clone
RC206236L4 10 µg

TEX12 (NM_031275) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ECM1 (Extracellular Matrix Protein 1) BioAssayTM ELISA Kit (Mouse) discontinued
355370-01 48 Tests

ECM1 (Extracellular Matrix Protein 1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
ECM1 (Extracellular Matrix Protein 1) BioAssayTM ELISA Kit (Mouse) discontinued
355370-02 96 Tests

ECM1 (Extracellular Matrix Protein 1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
3,5-Diamino-2,4,6-triiodobenzoic Acid
TRC-D416820-1G 1 g

3,5-Diamino-2,4,6-triiodobenzoic Acid

Sign In for Pricing
View Details
Human NMB shRNA Plasmid
abx953205-01 150 µg

Human NMB shRNA Plasmid

Sign In for Pricing
View Details