Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tlr12 shRNA (UAS) - Lentiviral mouse Tlr12 shRNA (UAS, GFP) (100)
GTR15301380 1 Vial

Lentiviral mouse Tlr12 shRNA (UAS) - Lentiviral mouse Tlr12 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
mmu-miR-7053-5p miRNA Inhibitor
MIM02877 2x 5.0 nmol

mmu-miR-7053-5p miRNA Inhibitor

Sign In for Pricing
View Details
WTAP Rabbit Monoclonal Antibody
E38QA8015 100 µL

WTAP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MCF2 Antibody, FITC conjugated
A28302-100UL 100 µL

MCF2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Human AgRP / AGRP Protein (His tag)
MBS2546545-01 0.05 mg

Recombinant Human AgRP / AGRP Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human AgRP / AGRP Protein (His tag)
MBS2546545-02 5x 0.05 mg

Recombinant Human AgRP / AGRP Protein (His tag)

Sign In for Pricing
View Details