Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUC7L Recombinant Protein (Human)
RP018415 100 µg

LUC7L Recombinant Protein (Human)

Sign In for Pricing
View Details
Neurl3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6467105 3x 1.0 µg

Neurl3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
RP-182-PEG3-K (palmitic acid) (TFA)
HY-169089A 1 Each

RP-182-PEG3-K (palmitic acid) (TFA)

Sign In for Pricing
View Details
Recombinant Human ARL2
MBS7613290-01 0.05 mg

Recombinant Human ARL2

Sign In for Pricing
View Details
Recombinant Human ARL2
MBS7613290-02 0.2 mg

Recombinant Human ARL2

Sign In for Pricing
View Details
Recombinant Human ARL2
MBS7613290-03 1 mg

Recombinant Human ARL2

Sign In for Pricing
View Details