Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Norwalk Virus (1C9)
sc-53557 200 µg/mL

Norwalk Virus (1C9)

Sign In for Pricing
View Details
ZNF673 3'UTR Luciferase Stable Cell Line
TU029354 1.0 mL

ZNF673 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit 1,5-Anhydroglucitol (1,5-AG) ELISA Kit
EIA05152Rb 1 Kit

Rabbit 1,5-Anhydroglucitol (1,5-AG) ELISA Kit

Sign In for Pricing
View Details
Anti-Human CD4 Purified
MBS696651-01 0.1 mg

Anti-Human CD4 Purified

Sign In for Pricing
View Details
Anti-Human CD4 Purified
MBS696651-02 5x 0.1 mg

Anti-Human CD4 Purified

Sign In for Pricing
View Details
HSD11B1L, CT (HSD11B1L, HSD3, SCDR10, Hydroxysteroid 11-beta-dehydrogenase 1-like protein, 11-beta-hydroxysteroid dehydrogenase type 3, Short-chain dehydrogenase/reductase 10) (Azide free) (HRP) discontinued
036775-HRP 200 µL

HSD11B1L, CT (HSD11B1L, HSD3, SCDR10, Hydroxysteroid 11-beta-dehydrogenase 1-like protein, 11-beta-hydroxysteroid dehydrogenase type 3, Short-chain dehydrogenase/reductase 10) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details