GDF-15, Mouse (HEK293, His-Flag)
The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.
Product Specifications
Product Name Alternative
GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html
Purity
98.0
Smiles
SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Molecular Formula
23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)
Molecular Weight
Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal Cathepsin E Antibody [DyLight 755]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Rabbit Polyclonal Cathepsin E Antibody [DyLight 755]
SLC16A10, CT (SLC16A10, MCT10, TAT1, Monocarboxylate transporter 10, Aromatic amino acid transporter 1, Solute carrier family 16 member 10, T-type amino acid transporter 1)
