Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-SOCS2-shRNA1-CopGFP-Puro Plasmid
PVT64460 2 µg

PLV3-U6-SOCS2-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
LOC500625 3'UTR GFP Stable Cell Line
TU260223 1.0 mL

LOC500625 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Trim34b AAV Vector (Mouse) (CMV)
47774104 1 µg

Trim34b AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Rabbit Anti-Human FAM98A pAb
PA9469-01 50 μL

Rabbit Anti-Human FAM98A pAb

Sign In for Pricing
View Details
Rabbit Anti-Human FAM98A pAb
PA9469-02 100 μL

Rabbit Anti-Human FAM98A pAb

Sign In for Pricing
View Details
ZNF620 Recombinant Protein Antigen
NBP2-68752PEP 100 µL

ZNF620 Recombinant Protein Antigen

Sign In for Pricing
View Details