Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UDP-Glucose Ceramide Glucosyltransferase (UGCG) Antibody
abx008592-01 30 µL

UDP-Glucose Ceramide Glucosyltransferase (UGCG) Antibody

Sign In for Pricing
View Details
UDP-Glucose Ceramide Glucosyltransferase (UGCG) Antibody
abx008592-02 100 µL

UDP-Glucose Ceramide Glucosyltransferase (UGCG) Antibody

Sign In for Pricing
View Details
UDP-Glucose Ceramide Glucosyltransferase (UGCG) Antibody
abx008592-03 200 µL

UDP-Glucose Ceramide Glucosyltransferase (UGCG) Antibody

Sign In for Pricing
View Details
Mapk1 Rat shRNA Lentiviral Particle (Locus ID 116590)
TL712194V 500 µL Each

Mapk1 Rat shRNA Lentiviral Particle (Locus ID 116590)

Sign In for Pricing
View Details
C1orf185 protein, Human, Recombinant (His)
E51P80284 20 µg

C1orf185 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Zfp661 (NM_001111029) Mouse Tagged ORF Clone
MG223727 10 µg

Zfp661 (NM_001111029) Mouse Tagged ORF Clone

Sign In for Pricing
View Details