Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNTB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678921 1.0 µg DNA

FNTB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Arhgap39 Mouse shRNA Lentiviral Particle (Locus ID 223666)
TL509774V 500 µL Each

Arhgap39 Mouse shRNA Lentiviral Particle (Locus ID 223666)

Sign In for Pricing
View Details
GENLISA™ Rat Coagulation Factor II (F2) ELISA
KLR0487 1x 96 Well

GENLISA™ Rat Coagulation Factor II (F2) ELISA

Sign In for Pricing
View Details
LINC00161 Human shRNA Plasmid Kit (Locus ID 118421)
TR319976 1 Kit

LINC00161 Human shRNA Plasmid Kit (Locus ID 118421)

Sign In for Pricing
View Details
Rabbit Polyclonal TR4/NR2C2 Antibody [Alexa Fluor 750]
NBP2-97138AF750 0.1 mL

Rabbit Polyclonal TR4/NR2C2 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
CARD10 ORF Vector (Human) (pORF)
ORF012574 1.0 µg DNA

CARD10 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details