Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nlgn1 (718-843, Cytopl. Dom.) Mouse Monoclonal Antibody [Clone ID: S97A-31]
AM60061PU-N 100 µg

Nlgn1 (718-843, Cytopl. Dom.) Mouse Monoclonal Antibody [Clone ID: S97A-31]

Sign In for Pricing
View Details
Anti-AIMP1 /  SCYE1 (aa137-149) antibody
STJ72797 100 µg

Anti-AIMP1 / SCYE1 (aa137-149) antibody

Sign In for Pricing
View Details
CD34 (NM_001025109) Human Recombinant Protein
PROTP28906 20 µg

CD34 (NM_001025109) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Human CD194/CCR4 Antibody (SAA0069)
HW634107 100 µg

Anti-Human CD194/CCR4 Antibody (SAA0069)

Sign In for Pricing
View Details
Human MEAK7 Knockout HEK293T cell line
GTR15407636 1 Vial

Human MEAK7 Knockout HEK293T cell line

Sign In for Pricing
View Details
ARL6IP5 Protein Vector (Human) (pPM-N-D-C-HA)
PV323776 500 ng

ARL6IP5 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details