Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cx3cl1 Mouse siRNA Oligo Duplex (Locus ID 20312)
SR426672 1 Kit

Cx3cl1 Mouse siRNA Oligo Duplex (Locus ID 20312)

Sign In for Pricing
View Details
Bora (Protein Aurora Borealis, HsBora, C13orf34)
B2557-01 100 µg

Bora (Protein Aurora Borealis, HsBora, C13orf34)

Sign In for Pricing
View Details
RGD1308396 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV644869 1.0 µg DNA

RGD1308396 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Rat SPAST Protein, His (Fc)-Avi-tagged
SPAST-5344R 50 µg

Recombinant Rat SPAST Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rabbit Anti-MSMB Polyclonal Antibody
PAV2372 100 μL

Rabbit Anti-MSMB Polyclonal Antibody

Sign In for Pricing
View Details
pCMV-PFKFB3-EGFP-Neo Plasmid
PVT47053 2 µg

pCMV-PFKFB3-EGFP-Neo Plasmid

Sign In for Pricing
View Details