Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF276 Protein Vector (Human) (pPB-C-His)
PV060133 500 ng

ZNF276 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human Creatine Kinase, Muscle/CKMM ELISA Kit (Colorimetric)
NBP2-75305 1 Kit

Human Creatine Kinase, Muscle/CKMM ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
PRKD3 Polyclonal Antibody, Cy7 Conjugated
bs-4157R-Cy7 100 µL

PRKD3 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Ptpn7 activation kit by CRISPRa
GA216428 1 Kit

Mouse Ptpn7 activation kit by CRISPRa

Sign In for Pricing
View Details
Polyclonal CES1 antibody - C-terminal region
APG02529G 0.1mg

Polyclonal CES1 antibody - C-terminal region

Sign In for Pricing
View Details
RPS10P23 AAV Vector (Human) (CMV)
42028101 1 µg

RPS10P23 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details