Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf103 (LRIF1) (NM_001006945) Human Tagged ORF Clone
RC203729 10 µg

C1orf103 (LRIF1) (NM_001006945) Human Tagged ORF Clone

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[RPA-2.10]
E-AB-F1375D-01 20 Tests

PE Anti-Human CD2 Antibody[RPA-2.10]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[RPA-2.10]
E-AB-F1375D-02 100 Tests

PE Anti-Human CD2 Antibody[RPA-2.10]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[RPA-2.10]
E-AB-F1375D-03 2x 100 Tests

PE Anti-Human CD2 Antibody[RPA-2.10]

Sign In for Pricing
View Details
RWPE-1
ARI0102 1 Million

RWPE-1

Sign In for Pricing
View Details
PAEP (NM_001018049) Human Tagged ORF Clone Lentiviral Particle
RC220904L3V 200 µL

PAEP (NM_001018049) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details