Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, His-Flag)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-his-flag.html

Purity

98.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCAT Antibody, FITC conjugated
A44500-50UG 50 µg

LCAT Antibody, FITC conjugated

Sign In for Pricing
View Details
FUSIP1 (SRSF10) (NM_001300937) Human Tagged ORF Clone
RC236652 10 µg

FUSIP1 (SRSF10) (NM_001300937) Human Tagged ORF Clone

Sign In for Pricing
View Details
CHOLESTAN-5α, 6α-EPOXY-3β-OL
504960 Inquire

CHOLESTAN-5α, 6α-EPOXY-3β-OL

Sign In for Pricing
View Details
OBCAM (E201) polyclonal antibody
BS2841-01 50 µL

OBCAM (E201) polyclonal antibody

Sign In for Pricing
View Details
OBCAM (E201) polyclonal antibody
BS2841-02 100 µL

OBCAM (E201) polyclonal antibody

Sign In for Pricing
View Details
Mouse Monoclonal ILK Antibody (OTI2H3) [DyLight 680]
NBP2-71037FR 0.1 mL

Mouse Monoclonal ILK Antibody (OTI2H3) [DyLight 680]

Sign In for Pricing
View Details