Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MecA, S. aureus (His-SUMO)

The MecA protein plays a crucial role in cellular machinery by facilitating the recognition and targeting of unfolded and aggregated proteins, directing them to the ClpC protease or other proteins involved in proteolysis. The function of this protein is critical for the efficient removal and degradation of abnormal proteins, ensuring cellular homeostasis and preventing the accumulation of potentially harmful protein aggregates. MecA Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived MecA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

MecA Protein, S. aureus (His-SUMO), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/meca-protein-s-aureus-his-sumo.html

Purity

90.00

Smiles

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Molecular Formula

/ (Gene_ID) P60186 (M1-E239) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant hHR23A Antibody
RC-16146-01 50 μL

Recombinant hHR23A Antibody

Sign In for Pricing
View Details
Recombinant hHR23A Antibody
RC-16146-02 100 µL

Recombinant hHR23A Antibody

Sign In for Pricing
View Details
Recombinant hHR23A Antibody
RC-16146-03 1 mL

Recombinant hHR23A Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS643222 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
WEE2-AS1 Human qPCR Primer Pair (NM_173677)
HP218460 200 Reactions

WEE2-AS1 Human qPCR Primer Pair (NM_173677)

Sign In for Pricing
View Details
Polystyrene A Br
HA12516001.25G 25 g

Polystyrene A Br

Sign In for Pricing
View Details