Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MecA, S. aureus (His-SUMO)

The MecA protein plays a crucial role in cellular machinery by facilitating the recognition and targeting of unfolded and aggregated proteins, directing them to the ClpC protease or other proteins involved in proteolysis. The function of this protein is critical for the efficient removal and degradation of abnormal proteins, ensuring cellular homeostasis and preventing the accumulation of potentially harmful protein aggregates. MecA Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived MecA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

MecA Protein, S. aureus (His-SUMO), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/meca-protein-s-aureus-his-sumo.html

Purity

90.00

Smiles

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Molecular Formula

/ (Gene_ID) P60186 (M1-E239) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butyrylcholinesterase (BChE) Fluorescent Activity Kit
K016-F1 2 Plates

Butyrylcholinesterase (BChE) Fluorescent Activity Kit

Sign In for Pricing
View Details
BMAL1 Recombinant Rabbit Monoclonal Antibody [JM17-34]
ET1705-5 100 µL

BMAL1 Recombinant Rabbit Monoclonal Antibody [JM17-34]

Sign In for Pricing
View Details
MAD4 (MXD4) Rabbit Polyclonal Antibody
TA378808 100 µL

MAD4 (MXD4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GCH1 Recombinant Rabbit monoclonal Antibody
HA722937 100 µL

GCH1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
DNAJB14 (NM_001278311) Human Tagged ORF Clone
RG235678 10 µg

DNAJB14 (NM_001278311) Human Tagged ORF Clone

Sign In for Pricing
View Details
Glucokinase (GCK) (NM_000162) Human Over-expression Lysate
LY400059 100 µg

Glucokinase (GCK) (NM_000162) Human Over-expression Lysate

Sign In for Pricing
View Details