Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKG2A, Human (Biotinylated, HEK293, His-Avi)

The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived NKG2A protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Product Specifications

Product Name Alternative

NKG2A Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkg2a-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

RHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

Molecular Formula

3821 (Gene_ID) P26715-1 (R100-L233) (Accession)

Molecular Weight

32-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD25 Monoclonal Antibody (PE Conjugated) [PC-61.5.3]
MBS2558681-01 0.025 mg

Anti-Mouse CD25 Monoclonal Antibody (PE Conjugated) [PC-61.5.3]

Sign In for Pricing
View Details
Anti-Mouse CD25 Monoclonal Antibody (PE Conjugated) [PC-61.5.3]
MBS2558681-02 0.1 mg

Anti-Mouse CD25 Monoclonal Antibody (PE Conjugated) [PC-61.5.3]

Sign In for Pricing
View Details
Anti-Mouse CD25 Monoclonal Antibody (PE Conjugated) [PC-61.5.3]
MBS2558681-03 5x 0.1 mg

Anti-Mouse CD25 Monoclonal Antibody (PE Conjugated) [PC-61.5.3]

Sign In for Pricing
View Details
Human PPT2 Protein Lysate
MBS8417692-01 0.02 mg

Human PPT2 Protein Lysate

Sign In for Pricing
View Details
Human PPT2 Protein Lysate
MBS8417692-02 5x 0.02 mg

Human PPT2 Protein Lysate

Sign In for Pricing
View Details
Recombinant HAdV-4 E1B-19K Protein (aa 1-142)
VAng-Cr4303-500gEcoli 500 µg (E. coli)

Recombinant HAdV-4 E1B-19K Protein (aa 1-142)

Sign In for Pricing
View Details