Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galectin-4 (Lgals4)

Product Specifications

Product Name Alternative

Lactose-binding lectin 4 (Gal-4)

Abbreviation

Recombinant Mouse Lgals4 protein

Gene Name

Lgals4

UniProt

Q8K419

Expression Region

1-326aa

Organism

Mus musculus (Mouse)

Target Sequence

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Galectin that binds lactose and a related range of sugars.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.4 kDa

References & Citations

"Nucling mediates apoptosis by inhibiting expression of galectin-3 through interference with nuclear factor kappaB signalling." Liu L., Sakai T., Sano N., Fukui K. Biochem. J. 380:31-41 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYI Antibody, Biotin conjugated
CSB-PA719395LD01HU-01 50 µg

HYI Antibody, Biotin conjugated

Sign In for Pricing
View Details
HYI Antibody, Biotin conjugated
CSB-PA719395LD01HU-02 100 µg

HYI Antibody, Biotin conjugated

Sign In for Pricing
View Details
Eco Antibody
orb813806 2 mg

Eco Antibody

Sign In for Pricing
View Details
LGR4 Human Monoclonal Antibody (APC)
orb2972542-01 50 Tests

LGR4 Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details
LGR4 Human Monoclonal Antibody (APC)
orb2972542-02 100 Tests

LGR4 Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details
Human CCL2 /MCP-1 ELISA Kit
QY-E05427 96 Tests

Human CCL2 /MCP-1 ELISA Kit

Sign In for Pricing
View Details