Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galectin-4 (Lgals4)

Product Specifications

Product Name Alternative

Lactose-binding lectin 4 (Gal-4)

Abbreviation

Recombinant Mouse Lgals4 protein

Gene Name

Lgals4

UniProt

Q8K419

Expression Region

1-326aa

Organism

Mus musculus (Mouse)

Target Sequence

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Galectin that binds lactose and a related range of sugars.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.4 kDa

References & Citations

"Nucling mediates apoptosis by inhibiting expression of galectin-3 through interference with nuclear factor kappaB signalling." Liu L., Sakai T., Sano N., Fukui K. Biochem. J. 380:31-41 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mkrn3 (NM_011746) Mouse Tagged Lenti ORF Clone
MR208670L4 10 µg

Mkrn3 (NM_011746) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Photosystem I assembly protein Ycf4 (ycf4)
orb2930146-01 20 µg

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Recombinant Photosystem I assembly protein Ycf4 (ycf4)
orb2930146-02 100 µg

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
GBRR3 Antibody Blocking peptide
orb1458221 500 µg

GBRR3 Antibody Blocking peptide

Sign In for Pricing
View Details
Rat Monoclonal Oval Cell Marker Antibody (OC2-6E10) [DyLight 650]
NBP1-18981C 0.1 mL

Rat Monoclonal Oval Cell Marker Antibody (OC2-6E10) [DyLight 650]

Sign In for Pricing
View Details
ZNF687 CRISPR/Cas9 KO Plasmid (h)
sc-410071 20 µg

ZNF687 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details