Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSDMC, Human (His-SUMO)

GSDMC protein serves as the precursor of pore-forming proteins and undergoes cleavage to release Gasdermin-C. This N-terminal moiety binds to the membrane, forming pores with an inner diameter of 10 to 15 nm and inducing pyroptosis. GSDMC Protein, Human (His-SUMO) is the recombinant human-derived GSDMC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

GSDMC Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gsdmc-protein-human-his-sumo.html

Purity

90.00

Smiles

MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA

Molecular Formula

56169 (Gene_ID) Q9BYG8 (M1-A508) (Accession)

Molecular Weight

Approximately 73.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPDYA Polyclonal Antibody
E-AB-64746-01 60 µL

SPDYA Polyclonal Antibody

Sign In for Pricing
View Details
SPDYA Polyclonal Antibody
E-AB-64746-02 120 µL

SPDYA Polyclonal Antibody

Sign In for Pricing
View Details
SPDYA Polyclonal Antibody
E-AB-64746-03 200 µL

SPDYA Polyclonal Antibody

Sign In for Pricing
View Details
Manoalide
TRC-E678103-10MG 10 mg

Manoalide

Sign In for Pricing
View Details
Potassium Citrate Monobasic
TRC-P698710-500G 500 g

Potassium Citrate Monobasic

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF640R conjugate, 0.1mg/mL
BNC402007-100 1x 100 µL

MHC II, Mouse (MK-D6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details