GSDMC, Human (His-SUMO)
GSDMC protein serves as the precursor of pore-forming proteins and undergoes cleavage to release Gasdermin-C. This N-terminal moiety binds to the membrane, forming pores with an inner diameter of 10 to 15 nm and inducing pyroptosis. GSDMC Protein, Human (His-SUMO) is the recombinant human-derived GSDMC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Product Specifications
Product Name Alternative
GSDMC Protein, Human (His-SUMO), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gsdmc-protein-human-his-sumo.html
Purity
90.00
Smiles
MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA
Molecular Formula
56169 (Gene_ID) Q9BYG8 (M1-A508) (Accession)
Molecular Weight
Approximately 73.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS730524-01 48 Well
Bovine CytokeRatin Fragment Antigen 21.1 ELISA Kit
Sign In for Pricing
View Details MBS730524-02 96 Well
Bovine CytokeRatin Fragment Antigen 21.1 ELISA Kit
Sign In for Pricing
View Details MBS730524-03 5x 96 Well
Bovine CytokeRatin Fragment Antigen 21.1 ELISA Kit
Sign In for Pricing
View Details MBS730524-04 10x 96 Well
Bovine CytokeRatin Fragment Antigen 21.1 ELISA Kit
Sign In for Pricing
View Details