Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (HEK293)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (HEK293) is the recombinant human-derived OSM protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

OSM Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-hek293.html

Purity

98.0

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R221) (Accession)

Molecular Weight

Approximately 28-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-O-Octadecyl-2-O-benzyl-sn-glycerol
O-1360.0005 5.0g

1-O-Octadecyl-2-O-benzyl-sn-glycerol

Sign In for Pricing
View Details
Recombinant Candida Albicans TIF31 Protein (aa 1-363)
VAng-Lsx06121-inquire Inquire

Recombinant Candida Albicans TIF31 Protein (aa 1-363)

Sign In for Pricing
View Details
Dyx1c1 (NM_026314) Mouse Tagged ORF Clone
MG206674 10 µg

Dyx1c1 (NM_026314) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
COG4 Recombinant Protein (Human)
RP007585 100 µg

COG4 Recombinant Protein (Human)

Sign In for Pricing
View Details
EMX2 (Empty Spiracles Homeobox 2) (MaxLight 650)
MBS6227371-01 0.1 mL

EMX2 (Empty Spiracles Homeobox 2) (MaxLight 650)

Sign In for Pricing
View Details
EMX2 (Empty Spiracles Homeobox 2) (MaxLight 650)
MBS6227371-02 5x 0.1 mL

EMX2 (Empty Spiracles Homeobox 2) (MaxLight 650)

Sign In for Pricing
View Details