Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GITR, Mouse (HEK293, Fc-His)

GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Mouse (HEK293, Fc-His) is a recombinant protein with a C-terminal Fc label and a C-terminal His label, It consists of 132 amino acids (S22-H153) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

GITR Protein, Mouse (HEK293, Fc-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gitr-protein-mouse-hek-293-fc-his.html

Purity

98.0

Smiles

SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGH

Molecular Formula

21936 (Gene_ID) O35714-1 (S22-H153) (Accession)

Molecular Weight

Approximately 56 kDa

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidine Kinase 1 (8E14) Rabbit Monoclonal Antibody
E28M5030 100 µL

Thymidine Kinase 1 (8E14) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SIRT1 Rabbit Polyclonal Antibody (AP)
orb910490 100 µL

SIRT1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Mouse Monoclonal MAGEA4 Antibody (OTI2C1) [CoraFluor 1]
NBP2-72571CL1 0.1 mL

Mouse Monoclonal MAGEA4 Antibody (OTI2C1) [CoraFluor 1]

Sign In for Pricing
View Details
Anti-CD340/ERBB2/HER2/NEU (SYD983) Biosimilar (Monoclonal, IgG)
A136338 100 µL

Anti-CD340/ERBB2/HER2/NEU (SYD983) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
UGT1A5 Protein Vector (Rat) (pPM-C-HA)
49116026 500 ng

UGT1A5 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TGF beta 1 Rabbit mAb
MBS9468372-01 0.05 mL

TGF beta 1 Rabbit mAb

Sign In for Pricing
View Details