Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Mouse (CHO)

M-CSF Protein, Mouse (CHO) is a pro-inflammatory cytokine, binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes.

Product Specifications

Product Name Alternative

M-CSF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-mouse-cho.html

Purity

95.00

Smiles

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

Molecular Formula

12977 (Gene_ID) P07141-1 (K33-P187) (Accession)

Molecular Weight

Approximately 18-30 kDa under reduced (R) conditions, 35-44 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

References & Citations

[1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kunitz-type protease inhibitor 4, SPINT4 ELISA Kit
MBS9338178-01 48 Well

Human Kunitz-type protease inhibitor 4, SPINT4 ELISA Kit

Sign In for Pricing
View Details
Human Kunitz-type protease inhibitor 4, SPINT4 ELISA Kit
MBS9338178-02 96 Well

Human Kunitz-type protease inhibitor 4, SPINT4 ELISA Kit

Sign In for Pricing
View Details
Human Kunitz-type protease inhibitor 4, SPINT4 ELISA Kit
MBS9338178-03 5x 96 Well

Human Kunitz-type protease inhibitor 4, SPINT4 ELISA Kit

Sign In for Pricing
View Details
Human Kunitz-type protease inhibitor 4, SPINT4 ELISA Kit
MBS9338178-04 10x 96 Well

Human Kunitz-type protease inhibitor 4, SPINT4 ELISA Kit

Sign In for Pricing
View Details
CFAP96 Antibody
KC-42801-01 50 μL

CFAP96 Antibody

Sign In for Pricing
View Details
CFAP96 Antibody
KC-42801-02 100 µL

CFAP96 Antibody

Sign In for Pricing
View Details