Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREM-2, Mouse (HEK293, His)

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TREM-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trem-2-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFP

Molecular Formula

83433 (Gene_ID) Q99NH8-1 (L19-P168) (Accession)

Molecular Weight

Approximately 27-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LACTB (NM_171846) Human Tagged ORF Clone Lentiviral Particle
RC224931L3V 200 µL

LACTB (NM_171846) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NNO1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1437808 1.0 µg DNA

NNO1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal SCO2 Antibody [FITC]
NBP1-77274F 0.1 mL

Rabbit Polyclonal SCO2 Antibody [FITC]

Sign In for Pricing
View Details
Human DISP2 knockdown cell line
ABC-KD4212 1 Vial

Human DISP2 knockdown cell line

Sign In for Pricing
View Details
Thyroid Peroxidase (human) monoclonal antibody (TPO 47)
MBS566397-01 1 mL

Thyroid Peroxidase (human) monoclonal antibody (TPO 47)

Sign In for Pricing
View Details
Thyroid Peroxidase (human) monoclonal antibody (TPO 47)
MBS566397-02 5 mL

Thyroid Peroxidase (human) monoclonal antibody (TPO 47)

Sign In for Pricing
View Details