Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Niemann Pick C2/NPC2, Mouse (HEK293, His)

Niemann Pick C2/NPC2 Protein, a lysosomal protein, plays a critical role in cholesterol trafficking and lipid metabolism. It facilitates the transport of cholesterol from lysosomes to other cellular compartments. Understanding the functions of NPC2 Protein is vital for studying lipid disorders and developing therapeutic strategies targeting abnormal cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/niemann-pick-c2-npc2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

EPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQITS

Molecular Formula

67963 (Gene_ID) Q9Z0J0 (E20-S149) (Accession)

Molecular Weight

Approximately 15.9-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-500 1x 500 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details