Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Niemann Pick C2/NPC2, Mouse (HEK293, His)

Niemann Pick C2/NPC2 Protein, a lysosomal protein, plays a critical role in cholesterol trafficking and lipid metabolism. It facilitates the transport of cholesterol from lysosomes to other cellular compartments. Understanding the functions of NPC2 Protein is vital for studying lipid disorders and developing therapeutic strategies targeting abnormal cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/niemann-pick-c2-npc2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

EPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQITS

Molecular Formula

67963 (Gene_ID) Q9Z0J0 (E20-S149) (Accession)

Molecular Weight

Approximately 15.9-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal VAP-B Antibody (736904) [Janelia Fluor 549]
FAB58551I 0.1 mL

Mouse Monoclonal VAP-B Antibody (736904) [Janelia Fluor 549]

Sign In for Pricing
View Details
Anti-Mouse EPHA2 Polyclonal Antibody
MB738014-01 50 µg

Anti-Mouse EPHA2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse EPHA2 Polyclonal Antibody
MB738014-02 100 µg

Anti-Mouse EPHA2 Polyclonal Antibody

Sign In for Pricing
View Details
Human RASIP1 Knockout A549 cell line
GTR15409017 1 Vial

Human RASIP1 Knockout A549 cell line

Sign In for Pricing
View Details
Gm10035 AAV siRNA Pooled Vector
58192164 1.0 µg

Gm10035 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human AGTR2 sgRNA gene knockout kit - Lentiviral human AGTR2 sgRNA gene knockout kit (25)
GTR15372939 1 Vial

Lentiviral human AGTR2 sgRNA gene knockout kit - Lentiviral human AGTR2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details