Niemann Pick C2/NPC2, Mouse (HEK293, His)
Niemann Pick C2/NPC2 Protein, a lysosomal protein, plays a critical role in cholesterol trafficking and lipid metabolism. It facilitates the transport of cholesterol from lysosomes to other cellular compartments. Understanding the functions of NPC2 Protein is vital for studying lipid disorders and developing therapeutic strategies targeting abnormal cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/niemann-pick-c2-npc2-protein-mouse-hek293-his.html
Purity
95.00
Smiles
EPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQITS
Molecular Formula
67963 (Gene_ID) Q9Z0J0 (E20-S149) (Accession)
Molecular Weight
Approximately 15.9-19 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
![Rabbit Monoclonal Fc epsilon RI Antibody (IE7) [Alexa Fluor 405]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
Rabbit Monoclonal Fc epsilon RI Antibody (IE7) [Alexa Fluor 405]
Rabbit Polyclonal epithelial Sodium Channel beta Antibody
Recombinant Rhesus Macaque RDH10 Protein, His (Fc)-Avi-tagged
RPE65 Polyclonal Antibody, APC-Cy5.5 Conjugated
ZNF18 (Zinc Finger Protein 18, Heart Development-specific Gene 1 Protein, HDSG1, Zinc Finger Protein 535, ZNF535, Zinc Finger Protein KOX11, KOX11, Zinc Finger Protein with KRAB and SCAN Domains 6, ZKSCAN6) (MaxLight 650)