Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Niemann Pick C2/NPC2, Mouse (HEK293, His)

Niemann Pick C2/NPC2 Protein, a lysosomal protein, plays a critical role in cholesterol trafficking and lipid metabolism. It facilitates the transport of cholesterol from lysosomes to other cellular compartments. Understanding the functions of NPC2 Protein is vital for studying lipid disorders and developing therapeutic strategies targeting abnormal cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/niemann-pick-c2-npc2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

EPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQITS

Molecular Formula

67963 (Gene_ID) Q9Z0J0 (E20-S149) (Accession)

Molecular Weight

Approximately 15.9-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complexin1, Recombinant, Human, aa1-134, His-Tag
349808-01 100 µg

Complexin1, Recombinant, Human, aa1-134, His-Tag

Sign In for Pricing
View Details
Complexin1, Recombinant, Human, aa1-134, His-Tag
349808-02 500 µg

Complexin1, Recombinant, Human, aa1-134, His-Tag

Sign In for Pricing
View Details
H4IIE Cells
T1086 1x106 cells / 1.0 mL

H4IIE Cells

Sign In for Pricing
View Details
TCTA Rabbit Polyclonal Antibody (N-Term)
E28PB3560 100 µL

TCTA Rabbit Polyclonal Antibody (N-Term)

Sign In for Pricing
View Details
PIPETTE,10ML,PPW,PS,S,IND,50BAG/200
4488 50/pk

PIPETTE,10ML,PPW,PS,S,IND,50BAG/200

Sign In for Pricing
View Details
CD11a/LFA-1A/ITGAL polyclonal antibody
BS7402-01 50 µL

CD11a/LFA-1A/ITGAL polyclonal antibody

Sign In for Pricing
View Details