Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Niemann Pick C2/NPC2, Mouse (HEK293, His)

Niemann Pick C2/NPC2 Protein, a lysosomal protein, plays a critical role in cholesterol trafficking and lipid metabolism. It facilitates the transport of cholesterol from lysosomes to other cellular compartments. Understanding the functions of NPC2 Protein is vital for studying lipid disorders and developing therapeutic strategies targeting abnormal cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Niemann Pick C2/NPC2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/niemann-pick-c2-npc2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

EPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTALVHGILEGIRVPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQITS

Molecular Formula

67963 (Gene_ID) Q9Z0J0 (E20-S149) (Accession)

Molecular Weight

Approximately 15.9-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PECAM Antibody / CD31
V4509SAF-100UG 100 µg

Recombinant PECAM Antibody / CD31

Sign In for Pricing
View Details
Recombinant Human Latexin / LXN / TCI Protein (His tag)
MBS2546407-01 0.05 mg

Recombinant Human Latexin / LXN / TCI Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Latexin / LXN / TCI Protein (His tag)
MBS2546407-02 5x 0.05 mg

Recombinant Human Latexin / LXN / TCI Protein (His tag)

Sign In for Pricing
View Details
Ceftiofur hydrochloride
MBS578830 Inquire

Ceftiofur hydrochloride

Sign In for Pricing
View Details
Integrin  Alpha6 Monoclonal Antibody
JOT-MCA0785-01 50ul

Integrin Alpha6 Monoclonal Antibody

Sign In for Pricing
View Details
Integrin  Alpha6 Monoclonal Antibody
JOT-MCA0785-02 100ul

Integrin Alpha6 Monoclonal Antibody

Sign In for Pricing
View Details