Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 alpha (IL1A)

Product Specifications

Product Name Alternative

Hematopoietin-1

Abbreviation

Recombinant Human IL1A protein

Gene Name

IL1A

UniProt

P01583

Expression Region

113-271aa

Organism

Homo sapiens (Human)

Target Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Molecular Weight

22 kDa

References & Citations

Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs.March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D.Nature 315:641-647 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKBKB Recombinant Protein (Mouse)
RP143330 100 µg

IKBKB Recombinant Protein (Mouse)

Sign In for Pricing
View Details
TTLL7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV716408 1.0 µg DNA

TTLL7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Hsa-miR-6724-5p antagomir
HY-RI02008A-01 5 nmol

Hsa-miR-6724-5p antagomir

Sign In for Pricing
View Details
Hsa-miR-6724-5p antagomir
HY-RI02008A-02 20 nmol

Hsa-miR-6724-5p antagomir

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glycerol-3-Phosphate Acyltransferase, Mitochondrial (GPAM)
MBS2080686-01 0.1 mL

FITC-Linked Polyclonal Antibody to Glycerol-3-Phosphate Acyltransferase, Mitochondrial (GPAM)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glycerol-3-Phosphate Acyltransferase, Mitochondrial (GPAM)
MBS2080686-02 0.2 mL

FITC-Linked Polyclonal Antibody to Glycerol-3-Phosphate Acyltransferase, Mitochondrial (GPAM)

Sign In for Pricing
View Details