Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin-7 (MYH7), partial

Product Specifications

Product Name Alternative

(Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain, cardiac muscle beta isoform) (MyHC-beta)

Abbreviation

Recombinant Human MYH7 protein, partial

Gene Name

MYH7

UniProt

P12883

Expression Region

1-109aa

Organism

Homo sapiens (Human)

Target Sequence

MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRY

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Forms regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.5 kDa

References & Citations

"Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity." Winkelmann D.A., Forgacs E., Miller M.T., Stock A.M. Nat. Commun. 6:7974-7974 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CLEC4D/CLECSF8 Protein (His Tag)
PKSH031110 100 µg

Recombinant Human CLEC4D/CLECSF8 Protein (His Tag)

Sign In for Pricing
View Details
Clofenamide
TRC-C585600-50MG 50 mg

Clofenamide

Sign In for Pricing
View Details
NINJ1/Ninjurin-1 Rabbit Polyclonal Antibody
HA500367 100 µL

NINJ1/Ninjurin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H1]
TA504701BM 100 µL

Selenium Binding Protein 1 (SELENBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H1]

Sign In for Pricing
View Details
Phosphotyrosine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 16F4]
AM00128PU-N 100 µg

Phosphotyrosine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 16F4]

Sign In for Pricing
View Details
Usp7 Mouse Gene Knockout Kit (CRISPR)
KN318814LP 1 Kit

Usp7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details