B7-2/CD86, Mouse (HEK293, His)
B7-2/CD86 Protein, Mouse (HEK293, His), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation[1][2].
Product Specifications
Product Name Alternative
B7-2/CD86 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-mouse-hek293-his.html
Purity
95.0
Smiles
VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKHHHHHH
Molecular Formula
12524 (Gene_ID) P42082 (V24-K244) (Accession)
Molecular Weight
40-60 kDa
References & Citations
[1]K S Hathcock, et al. Comparative analysis of B7-1 and B7-2 costimulatory ligands: expression and function. J Exp Med. 1994 Aug 1;180 (2) :631-40.|[2]S Tsuyuki, et al. Costimulation through B7-2 (CD86) is required for the induction of a lung mucosal T helper cell 2 (TH2) immune response and altered airway responsiveness. J Exp Med. 1997 May 5;185 (9) :1671-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6290039-01 0.1 mL
CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding
Ask
View Details MBS6290039-02 5x 0.1 mL
CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding
Ask
View Details 
