Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-2/CD86, Mouse (HEK293, His)

B7-2/CD86 Protein, Mouse (HEK293, His), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation[1][2].

Product Specifications

Product Name Alternative

B7-2/CD86 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-mouse-hek293-his.html

Purity

95.0

Smiles

VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKHHHHHH

Molecular Formula

12524 (Gene_ID) P42082 (V24-K244) (Accession)

Molecular Weight

40-60 kDa

References & Citations

[1]K S Hathcock, et al. Comparative analysis of B7-1 and B7-2 costimulatory ligands: expression and function. J Exp Med. 1994 Aug 1;180 (2) :631-40.|[2]S Tsuyuki, et al. Costimulation through B7-2 (CD86) is required for the induction of a lung mucosal T helper cell 2 (TH2) immune response and altered airway responsiveness. J Exp Med. 1997 May 5;185 (9) :1671-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

1-Hydroxypyridine-2-thione Zinc
TRC-H249820-10G 10 g

1-Hydroxypyridine-2-thione Zinc

Ask
View Details
Rat Cytochrome P450 17A1,CYP17A1 ELISA KIT
JOT-EK2264Ra 96 wells

Rat Cytochrome P450 17A1,CYP17A1 ELISA KIT

Ask
View Details
Uncoated Rat PCSK9 (Proprotein convertase subtilisin/kexin type 9) ELISA Kit
E-UNEL-R0044-01 5x 96 Tests

Uncoated Rat PCSK9 (Proprotein convertase subtilisin/kexin type 9) ELISA Kit

Ask
View Details
Uncoated Rat PCSK9 (Proprotein convertase subtilisin/kexin type 9) ELISA Kit
E-UNEL-R0044-02 15x 96 Tests

Uncoated Rat PCSK9 (Proprotein convertase subtilisin/kexin type 9) ELISA Kit

Ask
View Details
VEGFR-2 (Vascuoar Endothelial cell Growth Factor Receptor 2) Mouse ELISA Kit
I2184 96 Tests

VEGFR-2 (Vascuoar Endothelial cell Growth Factor Receptor 2) Mouse ELISA Kit

Ask
View Details
Manual Pipette Controller BPIP-406
BPIP-406 1 Unit

Manual Pipette Controller BPIP-406

Ask
View Details