Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACYP1, Human (His)

ACYP1 Protein, Human (His) is human recombinant Acylphosphatase-1 (ACYP1) with an N-terminal His tag. Recombinant Human Acylphosphatase-1, His is expressed in E. coli.

Product Specifications

Product Name Alternative

ACYP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acyp1-protein-human-his.html

Smiles

HHHHHHMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK

Molecular Formula

97 (Gene_ID) P07311 (M1-K99) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Degl'Innocenti D, ACYP1 gene possesses two alternative splicing forms that induce apoptosis. IUBMB Life. 2004 Jan;56 (1) :29-33.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS13 Rabbit Polyclonal Antibody
AP14085PU-N 400 µL

ADAMTS13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RFC5 (Center) Rabbit Polyclonal Antibody
AP12462PU-N 400 µL

RFC5 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLP2 Human Gene Knockout Kit (CRISPR)
KN422024 1 Kit

PLP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (C68/684), CF740 conjugate, 0.1mg/mL
BNC740684-100 1x 100 µL

CD68 (C68/684), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Noggin/NOG, Tag Free
HA210726-01 20 µg

Human Noggin/NOG, Tag Free

Sign In for Pricing
View Details
Human Noggin/NOG, Tag Free
HA210726-02 50 µg

Human Noggin/NOG, Tag Free

Sign In for Pricing
View Details