Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1, Human (His)

The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NFKB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nfkb1-protein-human-his.html

Purity

98.0

Smiles

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG

Molecular Formula

4790 (Gene_ID) P19838-2 (M1-G434) (Accession)

Molecular Weight

Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Breast, left
CB648898 1 Block

Frozen Tissue Blocks, Breast, left

Sign In for Pricing
View Details
Tissue Total RNA, Lung: left lower lobe
CR562571 5 µg

Tissue Total RNA, Lung: left lower lobe

Sign In for Pricing
View Details
PYGO1 Antibody
KC-42238-01 50 μL

PYGO1 Antibody

Sign In for Pricing
View Details
PYGO1 Antibody
KC-42238-02 100 µL

PYGO1 Antibody

Sign In for Pricing
View Details
PYGO1 Antibody
KC-42238-03 1 mL

PYGO1 Antibody

Sign In for Pricing
View Details
PE Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802D-01 20 Tests

PE Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details