Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1, Human (His)

The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NFKB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nfkb1-protein-human-his.html

Purity

98.0

Smiles

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG

Molecular Formula

4790 (Gene_ID) P19838-2 (M1-G434) (Accession)

Molecular Weight

Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3 gamma chain (23-116, His-tag) Human Protein
AR50824PU-N 500 µg

CD3 gamma chain (23-116, His-tag) Human Protein

Sign In for Pricing
View Details
KRT18P28 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV766279 1.0 µg DNA

KRT18P28 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
pLVX-U6-CCL20-shRNA1-PGK-EGFP-E2A-Puro Plasmid
PVT40945 2 µg

pLVX-U6-CCL20-shRNA1-PGK-EGFP-E2A-Puro Plasmid

Sign In for Pricing
View Details
Tp53inp1 sgRNA CRISPR Lentivector set (Rat)
K7247201 3x 1.0 µg

Tp53inp1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Metallothionein (mymT) Antibody (ATTO 680)
abx448214 100 µg

Metallothionein (mymT) Antibody (ATTO 680)

Sign In for Pricing
View Details
NXF1 Antibody - N-terminal region : FITC (ARP40638_P050-FITC)
ARP40638_P050-FITC 100 µL

NXF1 Antibody - N-terminal region : FITC (ARP40638_P050-FITC)

Sign In for Pricing
View Details