Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)

Product Specifications

Product Name Alternative

Cysteine-rich repeat secretory protein 60

Abbreviation

Recombinant Mouse-ear cress PDLP7 protein

Gene Name

PDLP7

UniProt

Q0WPN8

Expression Region

31-298aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCSRGGDFSILHSFTLI

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Modulates cell-to-cell trafficking.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.3 kDa

References & Citations

"Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones." Kaneko T., Katoh T., Sato S., Nakamura Y., Asamizu E., Kotani H., Miyajima N., Tabata S. DNA Res. 6:183-195 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-100 1x 100 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF405S conjugate, 0.1mg/mL
BNC041990-100 1x 100 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details