Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin beta C chain (INHBC), partial

Product Specifications

Product Name Alternative

Activin beta-C chain

Abbreviation

Recombinant Human INHBC protein, partial

Gene Name

INHBC

UniProt

P55103

Expression Region

237-352aa

Organism

Homo sapiens (Human)

Target Sequence

GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hsf2 (NM_031694) Rat Tagged ORF Clone
RR210514 10 µg

Hsf2 (NM_031694) Rat Tagged ORF Clone

Ask
View Details
Multidrug Resistance (MDR1, Chloroquine Resistance Protein) (FITC)
324679-01 50 µg

Multidrug Resistance (MDR1, Chloroquine Resistance Protein) (FITC)

Ask
View Details
Multidrug Resistance (MDR1, Chloroquine Resistance Protein) (FITC)
324679-02 100 µg

Multidrug Resistance (MDR1, Chloroquine Resistance Protein) (FITC)

Ask
View Details
DDR1, ID (Epithelial Discoidin Domain-containing Receptor 1, Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor Tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyrosine Kinase RTK 6, HGK2, CD167 Antigen-like Family Member A, Mammary Carcinoma Kinase 10, MCK-10, CD167a, DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE) (APC) discontinued
D1649-01D-APC 200 µL

DDR1, ID (Epithelial Discoidin Domain-containing Receptor 1, Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor Tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyrosine Kinase RTK 6, HGK2, CD167 Antigen-like Family Member A, Mammary Carcinoma Kinase 10, MCK-10, CD167a, DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE) (APC) discontinued

Ask
View Details
Soil Profile Kit
2069790 1 Each

Soil Profile Kit

Ask
View Details
SHC2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
43702124 3x 1.0µg DNA

SHC2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Ask
View Details