Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial

Product Specifications

Product Name Alternative

PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor

Abbreviation

Recombinant Pig PTH1R protein, partial

Gene Name

PTH1R

UniProt

P50133

Expression Region

27-184aa

Organism

Sus scrofa (Pig)

Target Sequence

DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQGRPCLPEWDHILCWPLGAPGEVVAMPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATG9A qPCR Primer Pair
QH09069S 200 Tests

Human ATG9A qPCR Primer Pair

Sign In for Pricing
View Details
HSPE1, ID (10kD heat shock protein,Heat shock 10kDa protein 1) (Azide free) (HRP)
MBS6308764-01 0.2 mL

HSPE1, ID (10kD heat shock protein,Heat shock 10kDa protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
HSPE1, ID (10kD heat shock protein,Heat shock 10kDa protein 1) (Azide free) (HRP)
MBS6308764-02 5x 0.2 mL

HSPE1, ID (10kD heat shock protein,Heat shock 10kDa protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
COL11A1 Immunizing Peptide
MBS426687-01 0.1 mg

COL11A1 Immunizing Peptide

Sign In for Pricing
View Details
COL11A1 Immunizing Peptide
MBS426687-02 5x 0.1 mg

COL11A1 Immunizing Peptide

Sign In for Pricing
View Details
4-(2-Hydroxyethyl)piperazine-1-carbaldehyde
TRC-H414080-50MG 50 mg

4-(2-Hydroxyethyl)piperazine-1-carbaldehyde

Sign In for Pricing
View Details