Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G2E, Mouse (HEK293, His)

The PLA2G2E protein is a secreted calcium-dependent phospholipase A2 that targets extracellular phospholipids. It hydrolyzes the fatty acyl group at the sn-2 position, releasing unsaturated fatty acids, especially lysophosphatidylethanolamine. PLA2G2E Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G2E protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PLA2G2E Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g2e-protein-mouse-hek293-his.html

Purity

97.0

Smiles

NLVQFGVMIERMTGKPALQYNDYGCYCGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNLNTYNRKYAHYPNKLCTGPTPPC

Molecular Formula

26970 (Gene_ID) Q9QUL3 (N20-C142) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CALCRL Antibody
NLS6731 0.05 mL

Rabbit Polyclonal CALCRL Antibody

Sign In for Pricing
View Details
OSBPL6 Protein Lysate (Human) with C-Ha Tag
35757031 100 µg

OSBPL6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Human anti-human ST2 mAb (BST5)
E4A09G01-h5-100 100 µg

Human anti-human ST2 mAb (BST5)

Sign In for Pricing
View Details
Human MTNR1A (Melatonin Receptor 1A) Microsample ELISA Kit
orb2998321-01 48 Tests

Human MTNR1A (Melatonin Receptor 1A) Microsample ELISA Kit

Sign In for Pricing
View Details
Human MTNR1A (Melatonin Receptor 1A) Microsample ELISA Kit
orb2998321-02 96 Tests

Human MTNR1A (Melatonin Receptor 1A) Microsample ELISA Kit

Sign In for Pricing
View Details
Tubb5 Mouse shRNA Plasmid (Locus ID 22154)
TL502351 1 Kit

Tubb5 Mouse shRNA Plasmid (Locus ID 22154)

Sign In for Pricing
View Details