Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G2E, Mouse (HEK293, His)

The PLA2G2E protein is a secreted calcium-dependent phospholipase A2 that targets extracellular phospholipids. It hydrolyzes the fatty acyl group at the sn-2 position, releasing unsaturated fatty acids, especially lysophosphatidylethanolamine. PLA2G2E Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G2E protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PLA2G2E Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g2e-protein-mouse-hek293-his.html

Purity

97.0

Smiles

NLVQFGVMIERMTGKPALQYNDYGCYCGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNLNTYNRKYAHYPNKLCTGPTPPC

Molecular Formula

26970 (Gene_ID) Q9QUL3 (N20-C142) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT18P32 Protein Vector (Human) (pPM-C-HA)
PV089580 500 ng

KRT18P32 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
NLGN4X Rabbit Polyclonal Antibody (HRP)
orb2112968 100 µL

NLGN4X Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Adenosine A1 Receptor (ADORA1) Antibody
abx303011-01 20 µg

Adenosine A1 Receptor (ADORA1) Antibody

Sign In for Pricing
View Details
Adenosine A1 Receptor (ADORA1) Antibody
abx303011-02 50 µg

Adenosine A1 Receptor (ADORA1) Antibody

Sign In for Pricing
View Details
Adenosine A1 Receptor (ADORA1) Antibody
abx303011-03 100 µg

Adenosine A1 Receptor (ADORA1) Antibody

Sign In for Pricing
View Details
Adenosine A1 Receptor (ADORA1) Antibody
abx303011-04 200 µg

Adenosine A1 Receptor (ADORA1) Antibody

Sign In for Pricing
View Details