Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3PXD2A, Human (Myc, His)

SH3PXD2A is an adapter protein that plays a crucial role in the formation of invadopodia and podosomes, thereby enhancing the invasiveness of cancer cells. It interacts with ADAM, NOX and phosphoinositides and contributes to a variety of cellular processes. SH3PXD2A Protein, Human (Myc, His) is the recombinant human-derived SH3PXD2A protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

SH3PXD2A Protein, Human (Myc, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sh3pxd2a-protein-human-myc-his.html

Purity

90

Smiles

PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP

Molecular Formula

9644 (Gene_ID) Q5TCZ1 (P902-P986) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNA Ligase 1 (1A9), CF594 conjugate, 0.1mg/mL
BNC942177-500 1x 500 µL

DNA Ligase 1 (1A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.10), CF488A conjugate, 0.1mg/mL
BNC880848-100 1x 100 µL

CD31 / PECAM-1 (C31.10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF640R conjugate, 0.1mg/mL
BNC400021-500 1x 500 µL

Cytokeratin 18 (DC10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details